(  P9RP9SRP9Nw$UԏȀ%7@<gh9gh9gh9AP9;>j9;>j9DA0Oj9gh9e`/EFGHIJKLMNOPIj9Ij9Ij9emacsAAOj9Ij9Ij9R *<8gh9gh9<7fSTUVWXYZ[\]^_.(8gh9gh9r7R     2lV8gh9gh9ήA92/0123456789:;<6 &+j9gh9gh9/bin/busybox9 &+j9gh9gh9/bin/busybox; &+j9gh9gh9/bin/busybox= &+j9gh9gh9/bin/busybox? &+j9gh9gh9/bin/busyboxA &+j9gh9gh9/bin/busyboxC &+j9gh9gh9/bin/busyboxE &+j9gh9gh9/bin/busyboxG &+j9gh9gh9/bin/busyboxI &+j9gh9gh9/bin/busyboxK &+j9gh9gh9/bin/busyboxM &+j9gh9gh9/bin/busyboxO &+j9gh9gh9/bin/busyboxQ &+j9gh9gh9/bin/busyboxS &+j9gh9gh9/bin/busyboxU &+j9gh9gh9/bin/busyboxW &+j9gh9gh9/bin/busyboxY &+j9gh9gh9/bin/busybox[8gh9gh9C7HIJKLMNOPQRST^ &+j9gh9gh9/bin/busyboxa &+j9gh9gh9/bin/busyboxc &+j9gh9gh9/bin/busyboxe &+j9gh9gh9/bin/busyboxg &+j9gh9gh9/bin/busyboxi &+j9gh9gh9/bin/busyboxk &+j9gh9gh9/bin/busyboxm &+j9gh9gh9/bin/busyboxo &+j9gh9gh9/bin/busyboxq (+j9gh9gh9/bin/busyboxs 2+j9gh9gh9/bin/busyboxu (+j9gh9gh9/bin/busyboxw (+j9gh9gh9/bin/busyboxyX8gh9gh9G7F| )+j9gh9gh9/bin/busybox )+j9gh9gh9/bin/busybox/?+j9?+j9?+j9m8gh9gh9r7:8gh9gh9K7 )+j9gh9gh9/bin/busybox8gh9gh97F6789:;<=>?@AB8gh9gh9`qB9lYZ[\]^_`abcde 0+j9qh9qh9/sbin/suloginT ,+j9gh9gh9/bin/busybox ,+j9gh9gh9/bin/busybox,+j9gh9gh9uemacs8gh9gh9pd98gh9gh9#f90 ?i9(i9i9d{ -+j9gh9gh9/bin/busybox -+j9gh9gh9/bin/busybox -+j9gh9gh9/bin/busybox-+j9gh9gh9busybox -+j9gh9gh9/bin/busybox -+j9gh9gh9/bin/busybox -+j9gh9gh9/bin/busybox -+j9gh9gh9/bin/busybox -+j9gh9gh9/bin/busybox -+j9gh9gh9/bin/busybox -+j9gh9gh9/bin/busybox -+j9gh9gh9/bin/busybox .+j9gh9gh9/bin/busybox .+j9gh9gh9/bin/busybox .+j9gh9gh9/bin/busybox .+j9gh9gh9/bin/busybox .+j9gh9gh9/bin/busybox .+j9gh9gh9/bin/busybox .+j9gh9gh9/bin/busybox .+j9gh9gh9/bin/busybox .+j9gh9gh9/bin/busybox .+j9gh9gh9/bin/busybox .+j9gh9gh9/bin/busybox .+j9gh9gh9/bin/busybox .+j9gh9gh9/bin/busybox 0+j9gh9gh9/bin/busybox 0+j9gh9gh9/bin/busybox 0+j9gh9gh9/bin/busybox 0+j9gh9gh9/bin/busybox 0+j9gh9gh9/bin/busybox 0+j9gh9gh9/bin/busybox 0+j9gh9gh9/bin/busyboxA Oj9gh9c9!"#!Ҩ7gh9Ҩ7!Ҩ7gh9Ҩ7 *j9gh9gh9/proc/kcore!Ҩ7gh9Ҩ7!Ҩ7gh9Ҩ7!Ҩ7gh9Ҩ7*j9gh9gh9ram1!Ҩ7gh9Ҩ7$!Ҩ7gh9Ҩ7$!Ҩ7gh9Ҩ7 !Ҩ7gh9Ҩ7aҨ7gh9Ҩ7aҨ7gh9Ҩ7 aҨ7gh9Ҩ7 aҨ7gh9Ҩ7aӨ7gh9Ө7aӨ7gh9Ө7aӨ7gh9Ө7aӨ7gh9Ө7aӨ7gh9Ө7aӨ7gh9Ө7 aӨ7gh9Ө7 aӨ7gh9Ө7 aӨ7gh9Ө7  aӨ7gh9Ө7 "aӨ7gh9Ө7$aӨ7gh9Ө7&aӨ7gh9Ө7(!7gh97*aԨ7gh9Ԩ7,aԨ7gh9Ԩ7.aԨ7gh9Ԩ70aԨ7gh9Ԩ72aԨ7gh9Ԩ74aԨ7gh9Ԩ76aԨ7gh9Ԩ78aԨ7gh9Ԩ7:!Ԩ7gh9Ԩ7<!ը7gh9ը7>!ը7gh9ը7@!ը7gh9ը7B!ը7gh9ը7D!ը7gh9ը7F!ը7gh9ը7H!ը7gh9ը7J!ը7gh9ը7L!ը7gh9ը7N!ը7gh9ը7P!ը7gh9ը7R!ը7gh9ը7T!ը7gh9ը7V!ը7gh9ը7X!ը7gh9ը7Z!֨7gh9֨7\!֨7gh9֨7^!֨7gh9֨7`!֨7gh9֨7b!֨7gh9֨7d!֨7gh9֨7f!֨7gh9֨7h!֨7gh9֨7j!֨7gh9֨7l!֨7gh9֨7n!֨7gh9֨7p!֨7gh9֨7r!֨7gh9֨7 t!֨7gh9֨7 v!ר7gh9ר7x!7gh97@z!7gh97A|!7gh97B~!7gh97C!7gh97 *j9gh9gh9/proc/self/fd!7gh97!7gh97!7gh97!7gh97!7gh97!7gh97!7gh97!7gh97!7gh97*j9gh9gh9fd/0*j9gh9gh9fd/1*j9gh9gh9fd/2a7gh97a7gh97a7gh97a7gh97a7gh97a7gh97a7gh97a7gh97a7gh97a7gh97 !.7gh9.7!.7gh9.7!.7gh9.7!/7gh9/7!/7gh9/7!/7gh9/7!/7gh9/7!/7gh9/7!/7gh9/7!/7gh9/7!/7gh9/7a7gh97@a 7gh9 7Aa 7gh9 7Ba 7gh9 7Ca 7gh9 7Da 7gh9 7Ea 7gh9 7Fa 7gh9 7Ga 7gh9 7Ha 7gh9 7I!/7gh9/7!/7gh9/7!/7gh9/7!/7gh9/7!/7gh9/7!07gh907!07gh907!07gh907 !07gh907 !07gh907 !07gh907 !07gh907 !07gh907 !07gh907 !07gh907 !07gh907 !07gh907 !07gh907!17gh917!17gh917!17gh917!17gh917!17gh917!x).8gh9x).8l !17gh917 !17gh917!17gh917!17gh917!17gh917!17gh917!17gh917!27gh927!27gh927!27gh927!27gh927 !27gh927"!27gh927$!27gh927&!27gh927(!27gh927*!27gh927,!27gh927.!27gh9270!37gh9372!37gh9374!37gh9376!37gh9378!37gh937:!37gh937<!37gh937>!37gh937@!37gh937B!37gh937D!37gh937F!J9gh9J9 H!v7gh9c9d J!v7gh9c9 L!v7gh9c9 NA)P99Oj99Oj9$P8gh9gh9r7%Tg+P9gh9d7&'()*+,-./0X8gh9gh9g712\8gh9gh9d93`8gh9gh97d +P9Kj9Kj9yz{`8gh9gh9c9789lAOj9Oj9Oj9:ohIj9Ij9Ij9x%8gh9gh97<wdIj9Oj9O>j9Oj9wp?#Oj9#Oj9Oj9#Oj9root@bug.ucw.cz.1250]q8gh9gh9u7?8gh9gh97@P#Oj9#Oj9#Oj9r8gh9Nj9y7Nj9B8gh9Nj9_7Nj9C8gh9Nj9`7Nj9Dv8gh9Nj9w7Nj9EFx8gh9Nj9`7Nj9GH8gh9Nj9`7Nj9IJKL8gh9Nj9`7Nj9MB8gh9Nj9`7Nj9NB8gh9gh9a7O Oj99Oj9k+f99Oj9BPQRSTUVWXYZ[\Z8gh9ANj9~c9ANj9qrspb8gh9Nj9Lf9Nj94tuvwxyz{|}~AOj9gh9z4f9 +j9gh9gh9ld-2.0.7.soL8gh9gh97,&8gh9gh97 *j9gh9gh9ld-2.0.7.so *j9gh9gh9libc-2.0.7.so *j9gh9gh9ld-2.0.7.so8gh9gh97 *j9gh9gh9libnss_files-2.0.7.so,8gh9gh97        *j9gh9gh9libpthread-0.7.so*j9gh9gh9libpthread.so.0*j9gh9gh9libcrypt-2.0.7.so*j9gh9gh9dlibtermcap.so.2.0.8 *j9gh9gh9libcrypt.so.18gh9gh9q3.8FN O P Q R S T U V W X Y Z 8gh9gh9B7dd *j9gh9gh9libncurses.so.4.28gh9gh9e9d# $ % & ' ( ) * + , - . / 0AOj99>j99>j9AOj9gh9rk6AOj9hi9hi9u8gh9gh9GMf98gh9gh9Nf98gh9gh9QMf9AOj9+j9+j9  +j9gh9gh9/bin/busybox  +j9gh9gh9/bin/busybox8gh9gh97b +j9gh9gh9/bin/busybox +j9gh9gh9/bin/busybox +j9gh9gh9/bin/busybox +j9gh9gh9/bin/busybox +j9gh9gh9/bin/busybox +j9gh9gh9/bin/busyboxhD8gh9gh97&!AOj99>j99>j9vB<Kj9Kj9Kj9Kj9root@bug.ucw.cz.1201 +j9gh9gh9/bin/busybox,IOj9gh9 Q9i.AOj9;zh9;zh9j1AOj9gh97k4COj9gh97l7AOj9gh9\7m:AOj9nh9nh9nxAOj9nh9nh9ozAOj9nh9nh9p|AOj9nh9nh9q~nh9nh9nh9rssNqh9Qqh9Nqh9XBAOj9Oj9Oj9AOj9Oj9>zh9Oj9@zh9Nj9zh9Nj9"S1i9*j91i9*j9 "i9hi9hi9R gi9gi9gi9uʄ Tzi9Lj9zi9 )j9)j9)j9 Kj9ANj9*j9ANj9 . .. lost+found big bina dev etc- lib@ mntA procB rootF sbinT tmpU varYPusr ... ... . .. shifconfigbusybox catchgrpchmodchown cp date dd dfdmesg du echofalsefdflush grepgunzip gzip! head"hostname#mount$ kill% ln& ls'mkdir(mknod)mktemp* more+ mv, ps- pwd. rm/rmdir0sleep1inetd2 sync3 tar4 ftpd5slattach6telnetd7 tee8 nc9 stty:login; true<umount=emacs>uemacs?mountnfs@ muttAunameBusleepC zcatD mount_busyE [FbasenameG chvtHclearI deallocvtJdirnameK findL freeM idNkillallOlengthPloggerQlognameR mathSmkfifoELF T@44 (44@4@@@ p00@0@@@܁܁$PPP@P@U!U!/lib/ld.so.1; S@ B"@@@ p ppppp@ p pKp p patexit__libc_init_first_init_finimainexit__gmon_start____deregister_frame_info__register_frame_infostrcmpsuppressintfreesavestrckmallocstrlenmemcpyintpendingonintatabout1fmtstrchrout2outfmtnextoptargptrnullstrbltinlookuperrorprevdirpadvance__xstatstalloccdcomppathstrcpystacknleftsstrnleftstacknxtgrowstackstr__lxstatchdiroptlisthashcdsetvarout1strout1emptyoutbufpipemakejobforkshellclosecopyfdexeclreaderrnowaitforjobflushouthandlerabortexceptionlongjmpsigemptysetsigprocmaskrootshell_exitcommandnameerroutdoformatflushallfmtstrexitstatussetstackmarksetinputstringtokpushbackparsecmdpopstackmarkpopfileevalskipredirectpopredirdefunoutputpendingsigsdotrapexitshellloopnestskipcountoexitstatusexpandargcasematchfixredir__ctype_bfuncnestout2strvpathstrncmpfind_commandfind_builtinshellparamlocalvars__sigsetjmpfreeparampoplocalvarsmklocalmemoutcmdenvironbuiltinfuncoptptrfreestdoutlistsetvarexraiseclearredirsetvareqenvironmentshellexecgoodnamenumberoptschangedpathoptstunallocerrmsgexerrorexecveinitshellprocsetinputfilearg0setparamgrowstackblockcmdtablecommandtextprefixreadcmdfilebuiltincmdfreefunclastcmdentrycopyfuncparsekwdlookupaliasherefdexpdestxwriteifsfirstifslastpargbackqexparglookupvargetpwnamsqsyntaxmakestrspacearithbasesyntaxdqsyntaxevalbackcmdungrabstackstrbackgndpid__strtol_internalrootpidvifsexpdiropendirreaddirclosedirparsenextcparsenleftfcntlparselleftopenbasepfjobctltcgetpgrpinitialpgrpgetpgrpkillpgsetsignalsetpgidtcsetpgrpnjobsjobtabsys_sigliststrcatcurjobis_numberforkclosescriptclear_trapsgetpidignoresigfd0_redirected_pintreceivedsigactiontrapkillwait3cmdnextccmdnleftnmboxesvmpathvmailmailtimesignalminuscexerrnoresetinitprocargsgetuidgeteuidgetgidgetegidevalstringshowjobschkmailstoppedjobsjob_warningevaltreesetinputfdmallocreallocwritestackbaseoptargisattyumasksetmodegetmodegetrlimitsetrlimitsetinteractivesetjobctlshowvarscmdsetvarsafeunsetvardopromptneedpromptcheckkwdheredoclistpungetcredirnodelasttokenquoteflagwordtextbackquotelistheredocrmescapespgetcpushstringplinnostartlinnopreadbufferarisyntaxparsebackquotegrabstackblockpfgetsis_typewhichpromptvps1vps2redirliststrerrorexpandheret_wp_opt_wpgetgroupsckreallocsigmodegotsigstrcasecmpout_junkioctlvartabunsetfuncsigfillsetarith_startbufarith_bufarith_lex_resetyyerrflagyycharyyssyyvsyynerrsyysspyyvspyylexyylvalyyval_IO_stdin__IO_stdout_yytextyylengfwriteyywrapfileno_IO_stderr_fprintfbasebufinitvarenvironpopallfilesrmaliasesdeletefuncsshprocvarfuncblocksizefuncstringsizefuncblockfuncstring_procedure_table_procedure_string_table_procedure_table_size_DYNAMIC_LINK__rld_maplibc.so.6_DYNAMIC_GLOBAL_OFFSET_TABLE__gp_dispmemset__start_ftext_etext_fdata_gp_edata__bss_start_fbss_end.text.init.fini.data.rodata.sdata.sbss.bss T@ S@ B  ,@ S@ Ԛ BpBS@l Bl&PA+B0!?|yBW xBHm`B@t`B@"^A^AhBP~Bpw@BpBЇBXAxxB\y@TԚ@,Bpt_Aܚ*}B81<tFOeA\Bpe`B"k0xs@zB00AẊA~B"/Ap3A4@B"A`~BB"9A0B~BX}B}BpB"p%B+7>hBhGAPBW baALoA0~ЊAbAPAA A@|ЛA A ,@ A  A)3<AXD0JBR@X_@l8wؚ~B$@A"B$BА|BBw@lABB$@0A"uA)yAl5= aAGz@NPz@HV0~B"]bBTkAx},A`cAL|DDAuAHYAT``kBD@dB @x\@$  Bȡ $-(4B>pBGO@PfA]p5BcM@nN@w`@gApp ~Bd@B"~B" B"040B"8B"4\BX T,~B(4 B;AHE~B"MPBPWH]Xd!pPBDwP~lvADB"ALAT@~B"TAxA$DB"P@B"pB"@L`P(B"$+T3aBH9`B>vA,Gp~B"N~B"V}B"]~B"el}@p#AxyMA`CAtt~@<At~B"B" B"<~B"B"X+BT)B}B"B(dAA\B)B4&B=FQZf|ALnx$ A AA`AP@|eAh A  Q@ <' , `1 ; }BPD @O țW ̛\ PB"f x^Ahp  x   B"  }B"  \@ B   x`BX ԛ  L 4  ܛ ؛ DB8    P+ P7 > E B"L kBS ЀB4Z Pf 0BPn  v p B~ ! \A <[@< p@t Bd       # 1 E P@N d m 0Bt T@| T@ B   Ԛ Ԛ Ԛ KlwGPF=;=vI-z8/f}{-A@G7!R0HZ)&jh  4Mm?n#3kXE<L>:'* K9dSN a 9q,^ "%B? Q/3HC5):r eWDJ1ub8ic.7"E(`4#26x(6+ys0p%.U~Y> @ \ [T1A'$_5+V,<gD& !;|BFJ$2t]*OoICalias %s=%s alias: %s not found aHOMEHOME not set.CDPATHcan't cd to %s..%s PWDPipe call failed/bin/pwdpwdCannot exec /bin/pwdpwd command failed-n-e-E^<^<^<^<^<^<^<^>>>&<<&<<...???/=4=0=1=1= 1=/=,0=1=T2=h2=3=t3=(6=3=4=5=@5=5=,5=T5=6=6=}-+?=you have mail/etc/profile.profileENV Use "exit" to leave shell. Can't open %sOut of spacestunalloc p:rarg countIFSSu=%s,g=%s,o=%s %.4o Illegal number: %snofiles(descriptors)process(processes)locked memory(kbytes)memory(kbytes)coredump(blocks)stack(kbytes)data(kbytes)file(blocks)time(seconds)HSatfdsmcnplulimit: internal error (%c) ulimit: too many arguments unlimitedulimit: bad number %-20s unlimited %ld ulimit: bad limit Illegal number: %snounsetnotifyallexportnoclobberemacsviverbosextracestdinnoexecmonitorinteractiveignoreeofnogloberrexitBad -c optionCurrent option settings %-16s%s onoffIllegal option -o %sIllegal option -%ccan't shift that manyUsage: getopts optstring var [arg]OPTARGIllegal option -%c No arg for -%c option %dOPTINDNo arg for -%c option"!""esac""case""}""{""done""do""for""until""while""fi""elif""else""then""if"wordredirection"`"";;"")""(""|""||""&&""&"";"newlineend of file!esaccase}{donedoforuntilwhilefielifelsethenif@=}-+?=Bad for loop variableinexpecting "in"==P=Ȉ===Ȉ=`==Ȉ=Ȉ=Ȉ==}=Ȉ=Ȉ=Ȉ=Ȉ====Ȉ=Ȉ=Ї=Ȉ==Bad fd numberIllegal eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Bad substitutionEOF in backquote substitution؞=@=H=== ==x=x===h==%s unexpected (expecting %s)%s unexpected%s: %d: Syntax error: %s %d: %scannot open %s: %scannot create %s: %s@===8=8===Pipe call failed)(-o-a!-ef-ot-nt-lt-le-gt-ge-ne-eq><!==-S-L-G-O-h-n-z-t-s-k-g-u-p-b-c-d-f-e-x-w-r[]missing ]unknown operand===4==%s: %s%sargument expectedclosing paren expected =L=x========$=H===8===x===X=======X==X====X=X=X==0=%s: out of range%s: bad numberDEBUGSIGJUNK(31)SIGPWRSIGIOSIGWINCHSIGPROFSIGVTALRMSIGXFSZSIGXCPUSIGURGSIGTTOUSIGTTINSIGTSTPSIGSTOPSIGCONTSIGCHLDSIGJUNK(16)SIGTERMSIGALRMSIGPIPESIGUSR2SIGSEGVSIGUSR1SIGKILLSIGFPESIGBUSSIGIOTSIGTRAPSIGILLSIGQUITSIGINTSIGHUPEXIT%d: %s %s: bad trap==========================0123456789ABCDEF4===========P============T=\=====L===4=OPTIND=1PS2=> PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/binMAILPATH=MAIL=IFS= PS1=PS1=$ PS1=# %.*s: bad variable name%.*s: is read only%s Not in a functionList assignment not implementedvf`>L>L>L>L>L>L>L>L>L>L>L>L>L>L>p>L>L>L>L>L>L>L>p>L>L>>>8>p>L>X>h>%ld arithmetic expression: %s: "%s"syntax errordivision by zeroyacc stack overflowT(>p(>(>(>(>)>8)>X)>)>)>)>)>*>8*>X*>x*>*>*>*>+>(,>D,>`,>|,>                arith: syntax error: "%s" fatal flex scanner internal error--no action found2>0>2> 3>(3>03>83>@3>H3>P3>X3>`3>h3>p3>x3>3>3>3>3>3>3>3>3>3>3>3>4>P4>H4>fatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowout of dynamic memory in yy_create_buffer()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()%s ulimitaliaswaitunsetunaliasumasktypetrue:trap[testshiftsetvarsetreturnreadpwdlocaljobsjobidhashgetoptsfgfc-hfalsereadonlyexportletexpexitexecevalecho.commandchdircdcontinuebreakbgbuiltin    HP>TP>P>HP>HP>HP>HP>HP>P>HP>HP>P>HP>P>Q>Q>Q>Q>Q>|Q>|Q>Q>Q>Q>S>(S>|S>S>S>S>S>S>S>S>S>S>S>S>S>S>xT>xT>xT>HT>HT>xT>xT>T>             eh`b>^>^>^>^>^>|_>`b>`b>_>`>\a>$`>`>`>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>Lb>a>b><œ'!'L@L V9' $|9'  ''@*@!$\B$&B$\" ^9' \c$!$1!$"c$\#\C$!$# DtB@x B$Bc$c$! P#p!$$!$#('<'!'$`6$ $  c$cB$B!$$#d!C!$" '<̳'!B$Bc$c$<'!'!\B$ B$\"$!$"` c$cb\BB$\"\!$#!$" tB@x  ('<0'!'$1&1$,($ @gB$!$$C$C"?E&\BB$\"!$# x^9' $\c!$"!$2c$\#\C$!$#-EtB'@x  ! @ t_9' !@! !( !0`p B$B!$0!R!$",$ 0'<'!$$$ B$Bc$c!D#d!$"!$#<'!'$& *@!0$` B$B& `c9' B$Bc$c!P#pc$# ('<'!'&B # `c9' c$cB$B #p!P#('<'!c$cB$B#(!$$#d!C!$"#E"<'!'4! !$p$@<80,(p6$  @Q$!  @!  @ 1" @$t6$ $6$ !@`!$ĀB!"! '$ $C`@ $b!BB$"t@&\$b$ $q  $cb! ` @! @!\$b! '$ $CBB$"@@9"+@! ` #@B@Ȁ @!0$Ā1&܀ ĀB}$BB$"@q&Ȁ !@g&B@Ȁ  !@  @ĀB&+@! `$Ā!0$1&܀ "@!0!@840,($ H'<Ȩ'!'<!8!D@406$ @$\B! B$\" !@! @ \BB$\"\B @tB@x BPYL@"2@! r$$"2@@"2!w$b$@"2@'!x$b$!@ "2@! r$ $"2@"2!w$ b$"2@ '!x$ b$!@"2@! r$($"2@"2!w$(b$"2@('!x$(b$!@6$ O6$!(  Dc@!CBB0@! !b$B, @e6$ &B$!C!   @! @6$!( '(0 'D0 D<840!H'<'!' !,$0!$f$8S$4H$(a$@<\7$ !@` vTb(@u!`r!`$$$R&B@ BQR&B@B @l7$!(  BD+7!B @! 7$ 7$X <@6!:b( @!P@B$!C#0b(@1& `7$ BG'R&B@Q&t2$' b2@E7$ $<$l@"*@@B$ B,@|胁"p l! 상"􃁏#  $h!@胁#$R   $ !@ !@'P$ @' @%b $$@$ $b@'BЃcB$"ԃ#$'l '!(@!0 h$S >$!@$" !@&$$B":$$=" !@<$(&$$ !@$$ " "Q -$C$c bB @$$"" @B$"䃁1" $ !@($2{$-$&B, @_$&2c@!CBB0@($$!PBB0@($BhB$"$$bc$h m($$ ! @($1$ BhB$"$bBĀc$hB$"!`bb$h{$#d !@#$ !@}$#$ $!$A&B,?@&_$ 2c@!CBB02@&BB$"@hPȀ hPB$h !@$R&B,O@_$2c@!CBB0C@& B,@BhB$"pc$h !@& B,(@$!PBB0@BhB$"pc$h  !@<$$9' BB$"@=$h CȀ =$hCB$h1`!%$ &*@#$ :$$ !@:1&! !( @#QS$$#$!$ Qs& p@x@R6ĀB%r!TC$CbtB$>t'!( @@` $ $ \BhĀcB$#\"`! `h Ā!0`p B\BB$\"\c'" `tB@x @ $Ā1B`$"ԃB @$$9' ԃ !@U! *@$_n\$|g !@ BЃcB$" `$$9' ! $9' ><$$:p@"$4BB$"AȀ !@2!1&BЃcB$"ԃ#B<$ "$9' BB$"AȀ !@0a1&BB$"AȀ !@ 1&ĀB#" ! h !@! Ā!0 p ! $P @'@$ @#`! ЃBЃ $9' `!@Ѓ"$\9' $C! `$9' `Q` T , B*b@ĀBh":`!0`p \BcB$\"h#s#!Sh` \BB$\"\B @tB@x x("`p @BhB$"$:bBhB$"$/bxB$CxB$$chc$#$hBhB$" d'<M'!@$$ $ E!""C!$@$$!$!""!\@$BBB,D!$]bB&X@BB+D!$bJ@B&D$,9' @B:@C$6bB&D"$09' ZB,D!$%bB&!@B& D$,9' @B@C$ bB&D"$09' 1+B&D"D$,9' ! @$x9' D`P,$D" !>$$9' !( 0'<8'!'!!0`b @!(`$>$  ,>$!(  '<8'!'$ $9' Dcd$D$d!@$,9' $$ C! Dcb$D"d$,9' ! @$x9' @! !$ !Dcc$D#$('<6'!'$ $9' Dcd$D$d!@$,9' #$C! Dcb$D"d$,9' ! @$9' @!+ !Dcc$D#$('<5'!'"$ $9' Dcb$D"d$,9' ! @$9' B, '<4'!'! ! 0>$$9' %$:Dcb$D"d$,9' ! @$x9' D$D#!@$,9' &$ C! D>$$9' !@ZV@DBC$D#B @$0>$$9' $ .@ $&$R!DBDl OB,DBD$9' ! @ ;DBD!($D9' ,DBD$,9' @B@C$ b$09'  DBDl + ('<`1'!'DB($ PC$D#D$,9' Dcb$D"q@R D0>$$9' BB$b,@`>!$!""!\@! !( X B,! !( X +! !( X ! !( X *! $9' ! !@$9' &.! $9' ! !@$9' &n+! $9' ! !@$9' *Z:! $9' ! !@$9' G*P! $9' ! !@$9' *P3B8! $9' ! !@$9'  *! !( $09' ! !( $9'  ! !( $x9' ( 0'!$!""!\@! $! $! $$49' 4B,(4&@$$ $"`$ $4"$ $$H*h 4 &bp 8&b b, $,B0&CB,,$C+'$!( @!EB B0 @$!B@!EB B0@! `B @!(?$ ! ,$ 0'<`)'!'!<!8$!(@'D@ @!$!( ' @!X*C!D<8H'<('!'!<!8$!(@'D@ @!$!( ' @!X*b!D<8H'<('!'!<!8$!(@'D@ @!$!( '  @!b!(&CP,!D<8H'<\''!@'!!h $!@!(' !@$@$"!,IB0@!4R 8$9' @,$q`!$' !0`$29' U!@=$,$(=$+0$$@! &! @!( :@!@#2!b!`&!B!  !0`(!8.$29' !@&+0@! &! @!( @!@#2!b!`&!B! X$!0` !8$29' !@ &Â`,$b& ! @$ 49' !@XTLHD@<840`'<'!g$*h(@=$>(@+$-$$DX$$?o$u$$8-$ $$+$$)$g&0+ 0@0c4@$c4$+$ B4-$B4=$$B4$<'!!P+ $- $X $$BM!@L+$-$K!@NOJ%)%=@$BE!8C!8!0E%BL%8'$0$@M%0'$8$@K'$C%@$J% ')%$ &)%$ ()%$< '!'\B p$t$B$\"$,99' !@x \BB$\"\B @!tB@!x ! ('<ߜ'!'(($ b@(c@! $ĀcB" $BB$"AȀ !@&bc$@01&BB$"@rȀ !@rBB$"@`Ȁ @B# D !@B&! $p59' B$!@!( .( 0'<ܜ'!'!$ | "x B$pƌ!( @c!6*4@@ dB$!DB-C@cB$+bf@b$1&!$1"qcb$"d|c$"`b$|"@@&!!*@@dB$!CBD&!r@|B@B(C$$89' BB$"|BB(G@$|"H)%d%$J%$$@!IP&*@@!hBG++@!jQ$"cb$+@$c"c$#B@$"@R&!BR$c#R!CB&"b,@XC!$!""!\@BBBBcb@b @! BCB%b#@ BCB&bBCB$bBCB&bc,BCB*CBCB*bc8BCB*bBCB*CB8BCB&b+BCBCBCBCBCB!bBCB#bBCBbX+m@ BB @,C$$89' cbcC` $a<A BBB @,C$$89' cbcC` $a<A 8BBB,BB 'BB#BB"@ (@ctR&!BRB#d#q#E"0 @.@$b$"qcb$"dBA "A BI@@&!!*@@dB$!CB Q@1&!#1@D1&!"1cB$+b@b$"qcb$"]d@C$$89' $!( 0'<ќ'!'B$B840,($ F@B$B!$ @$!$"B$B@!$"ĐB$B@Đ!$"B$B@@$$$xY9' !$"$X9' THs&H&H&C&1&1B$B! "&@ !"cD$!( `!!$0!$1B0!D@DI!$!""DIc$P@TH$!VP!*@@!UE@!FB0!D@!CBP@!SB!@H&!@!SC$b1&@!TD #2&1&1@!TD#22""!$" !$1,W@J!$!""!\@B$B"1&1&@!( $!8 "9$7$5$3$1$/$-$+$) $' $% $# $! $$$$$$$$$$ $pI$ Đ$$ !B$Bc"$##$ @p$$$$!$"B$Bc$cB$!C+D3@B!P!$"$Q9' !@! @$S9' !@R`B$BB$!@!$"!`1&1@$M9' !@$ bb(@$8`Nb!$ @B$BB$!CCc!$#D$B$Bt@$$,W9' gB!P!$"$Q9' 1&1R\!@B$Bc$cB!C!$"$Q9' 1&1R!@I$$X_9' !80,($ @'<ǜ'!'1B$Bc$c($ c$PB$B!+b `tJ$$X_9' B$B B @c$cc$$$B$Bc#CR$@! "1&$*@&$$$b!$ [ >#R&B$B#C @@!b  $$_9'  @J$$X_9' B$B B!q!$##RB$@tB$BC$!rbc$c+!$"bB$B@!@$$$,W9' $B$B$Pc$cB$Bc!R!$"!b`c$cB$Bc!C@B$BC!#( 0'<Ü'!B$B$+_@TH)%Hk%HJ% @@D$!0Ɛ$CB$!CB @!i!$$!$'B0!E@DI!$!""DIc$D@TH%!KD!(@@!JF@!HB0!E@!CBD@!I$CB$B!@+H$! @!<œ'!@0CB$!FB$ @$!$$!$%THB$!FBTH$B$@DI!$!""DI$D@H%H$!HD!(@@!GC@!FB!b@!EBD@TH!$!""!b@H$! 8@!!!`<'!' B$Bc$cC$\@B$Bc$cB!C+@$LB!$##$M9' !@$bb(@$,`31b$$,W9'  4@$B$B@$$,W9' B!P!$"c$cb`$$!$#!$# ('@%|>@%x>@%t>@%p >@%0`>@%,d>@%(h>@%$l>@% p>@%t>@%x>@%|>@%>@% >@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%>@%@P@@%<T@@%8X@@%4\@@%0`@@%,d@@%(h@@%$l@@% p@@%t@@%x@@%|@@%@@% @@%@@%@@%@@%@@%@@%@@%@@%@@%@@%@@%@@%@@%@@%@@%@@%@@%@@%@@%@@%@@%@@%@@%A@%A@%A@% A@%A@%|A@%xA@%tA@%p A@%l$A@%h(A@%d,A@%`0A@%\4A@%X8A@%TC 2-Q ",X Kbh8I5#A6\FE7Z^`1&P4%!Ug<9$.0V:@cR da?fLJYO+WGMS('* )/3; B=[T_e]H100baseFX100baseTX100baseTdb15thickAUItpeutp10baseTcoaxbnc10base2unknownnet-tools 1.45ifconfig 1.33 (1998-03-02)lo%-8.8s Link encap:%s atmashHWaddr %s Media:%s%s(auto) %s addr:%s P-t-P:%s Bcast:%s Mask:%s [NO FLAGS] UP BROADCAST DEBUG LOOPBACK POINTOPOINT NOTRAILERS RUNNING NOARP PROMISC ALLMULTI SLAVE MASTER MULTICAST MTU:%d Metric:%d txqueuelen:%d RX packets:%lu errors:%lu dropped:%lu overruns:%lu frame:%lu compressed:%lu TX packets:%lu errors:%lu dropped:%lu overruns:%lu carrier:%lu Collisions:%lu compressed:%lu Interrupt:%d Base address:0x%x Memory:%lx-%lx DMA chan:%x /proc/net/devr%s: unknown interface. SIOCSIFFLAGSUsage: ifconfig [-a] [-i] [-v] interface [[family] address] [[-]broadcast [aa.bb.cc.dd]] [[-]pointopoint [aa.bb.cc.dd]] [netmask aa.bb.cc.dd] [dstaddr aa.bb.cc.dd] [hw class address] [metric NN] [mtu NN] [[-]trailers] [[-]arp] [[-]allmulti] [[-]promisc] [multicast] [mem_start NN] [io_addr NN] [irq NN] [media type] [txqueuelen len] [up] [down] ... %s %s socket-a-v-V-version--version-?-h-help--helpinetarp-arpmediaportautoUnknown media type. SIOCSIFMAPtrailers-trailerspromisc-promiscmulticast-multicastallmulti-allmultiupdownmetricSIOCSIFMETRIC: %s mtuSIOCSIFMTU: %s -broadcastbroadcastSIOCSIFBRDADDR: %s dstaddrSIOCSIFDSTADDR: %s netmaskSIOCSIFNETMASK: %s txqueuelenSIOCSIFTXQLEN: %s mem_startSIOCSIFMAP: %s io_addrirq-pointopointpointopointhw%s: invalid %s address. SIOCSIFHWADDR: %s Don't know how to set addresses for this family. SIOCSIFADDR: %s /proc/net/devrcompressedbytes%ld %ld %ld %ld %ld %ld %ld %ld %ld %ld %ld %ld %ld %ld %ld %ld%ld %ld %ld %ld %ld %ld %ld %ld %ld %ld %ld %ld %ld%ld %ld %ld %ld %ld %ld %ld %ld %ld %ld %ldNo usable address families found. ececonettcpipunixnetromddpappletalkipxinet6ip6inetipax25UNSPECUNIX DomainDARPA InternetPlease don't supply more than one address family. Too much address family arguments. ,Unknown address family `%s'. Local LoopbackUNSPECSerial Line IPVJ Serial Line IP6-bit Serial Line IPVJ 6-bit Serial Line IPAdaptive Serial Line IPEthernetPoint-to-Point Protocol%02X-[NONE SET]unspecloopslipcslipslip6cslip6adaptive%02X:%02X:%02X:%02X:%02X:%02X[NONE SET]etherYou cannot start PPP with this program. ppp%02X-[NONE SET]unixunspecdefault*[NONE SET]inetnetstattcpudpraw%d%seho>k>k>k> l>(l>l>o>o>l>n>n>Tm>m>m>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>|o>n>Ho>&<(&T\(&XP'P$d H@P@P'Āc@!CB B0@&@@Ȁ H! !0@T H@P'Ȁ H!C:$bP'! !(@̀ HP$c$c$+bb(@$Cb! Y$Vb! ($&&'&T "&4"& 0"&$"&(<X8"&,048D@Ѐ H5! h$&&'&T "&4X"& $(,08Ѐ H0 $T&&,X '& $(0Ѐ H  0 P| H|xtplhd`'C"EfCYC"dLCrC"{PC" hC"0C"qC C@CCCHC7C"LxC``C"CdC( CPpCp C"C*($.L<?N<[C"a@C"h0C"n@C"t C"}C"pC"C"C"C"sCC"C($sC,$0$C"PCLC"C(C`C"C ,C\ \Ch pCX / G ] k  P@   ȰC pC 8C C xC ĵC C LC C ԴC C C C @ @ C  ! #( #4 #: &'!*TC$\.kqf`!Jiz6j5Md":e3R%H2 x(@b> v aBn1r [E^$8ZL{/G_ ]#o~wtP%s,Om ?4A7NU<X  WQ9= #uyD gI|KV-l0 p&;}hSF" Yc)+basename FILE [SUFFIX] Strips directory path and suffixes from FILE. If specified, also removes any trailing SUFFIX. %s cat [FILE ...] Concatenates FILE(s) and prints them to the standard output. rchgrp [OPTION]... GROUP FILE... Change the group membership of each FILE to GROUP. Options: -R Changes files and directories recursively. chown [OPTION]... OWNER[<.|:>[GROUP] FILE... Change the owner and/or group of each FILE to OWNER and/or GROUP. Options: -R Changes files and directories recursively. chmod [-R] MODE[,MODE]... FILE... Each MODE is one or more of the letters ugoa, one of the symbols +-= and one or more of the letters rwxst. Options: -R Changes files and directories recursively. %s: unknown mode: %s chownchmod%s: unknown user name: %s %s: too few arguments %s: unknown group name: %s chvt N Changes the foreground virtual terminal to /dev/ttyN /dev/consoleVT_ACTIVATEVT_WAITACTIVEmv SOURCE DEST or: mv SOURCE... DIRECTORY Rename SOURCE to DEST, or move SOURCE(s) to DIRECTORY. cp [OPTION]... SOURCE DEST or: cp [OPTION]... SOURCE... DIRECTORY Copies SOURCE to DEST, or multiple SOURCE(s) to DIRECTORY. -a Same as -dpR -d Preserves links -p Preserves file attributes if possible -f force (implied; ignored) - always set -R Copies directories recursively /%s: rename(%s, %s): %s %s: link(%s, %s): %s %s: rmdir(%s): %s %s: unlink(%s): %s cp%s: getcwd(): %s %s: chdir(%s): %s %s: stat(%s) :%s %s: Cannot %s `%s' into a subdirectory of itself, `%s/%s' ;d;d;d;d;d;d;d;d;d;d;d;d;d;d;;d;d;(;d;P;d;d;d;d;d;d;d;d;d;<;date [OPTION]... [+FORMAT] or: date [OPTION] [MMDDhhmm[[CC]YY][.ss]] Displays the current time in the given FORMAT, or sets the system date. Options: -R Outputs RFC-822 compliant date string -s Sets time described by STRING -u Prints or sets Coordinated Universal Time %2d%2d%2d%2d%ddate%d:%d:%d%d:%d%d.%d-%d:%d:%d%d.%d-%d:%d%d.%d.%d-%d:%d:%d%d.%d.%d-%d:%dTZ=UTC0date<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;: can't set date. %a, %_d %b %Y %H:%M:%S GMT%a, %_d %b %Y %H:%M:%S %z%a %b %e %H:%M:%S %Z %Y %f%Y.%m.%d-%H:%M:%S%s dd [if=FILE] [of=FILE] [bs=N] [count=N] [skip=N] [seek=N] Copy a file, converting and formatting according to options if=FILE read from FILE instead of stdin of=FILE write to FILE instead of stdout bs=N read and write N bytes at a time count=N copy only N input blocks skip=N skip N input blocks seek=N skip N output blocks Numbers may be suffixed by w (x2), k (x1024), b (x512), or M (x1024^2) ifofcountBad count value %s bsBad block size value %s skipBad skip value %s seekBad seek value %s %ld+%d records in %ld+%d records out deallocvt N Deallocate unused virtual terminal /dev/ttyN /dev/consoleVT_DISALLOCATE%s: 0: illegal VT number %s: VT 1 cannot be deallocated %s: could not deallocate console %d df [filesystem ...] Print the filesystem space used and space available. /dev/root%-20s %9ld %9ld %9ld %3ld%% %s Y@?P?%-20s %-14s %s %s %s %s Filesystem1k-blocksUsedAvailableUse%Mounted on%s: can't find mount point. rdirname [FILENAME ...] Strips non-directory suffix from FILENAME %s .dmesg [-c] [-n LEVEL] [-s SIZE] Prints or controls the kernel ring buffer Options: -c Clears the ring buffer's contents after printing -n LEVEL Sets console logging level -s SIZE Use a buffer of size SIZE klogctldu [OPTION]... [FILE]... Summarizes disk space used for each FILE and/or directory. Disk space is printed in units of 1024 bytes. Options: -l count sizes many times if hard linked -s display only a total for each argument %ld %s du: %s: %s ...du%s/%sdu: invalid option -- %c dutmp [FILE] Dump utmp file format (pipe delimited) from FILE or stdin to stdout. (i.e. 'dutmp /var/run/utmp') %d|%d|%s|%s|%s|%s|%s|%lx echo [-neE] [ARG ...] Prints the specified ARGs to stdout Options: -n suppress trailing newline -e interpret backslash-escaped characters (i.e. \t=tab etc) -E disable interpretation of backslash-escaped characters -n-e-E--R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;R;S;R;R;R;R;LR;TR;\R;R;R;tR;R;R;R;R;R;R;R;|R;R;R;R;R;R;R;R;R;-move-step-rgba-bcast-extsync-gsync-csync-timings-vslen-hslen-lower-upper-right-left-pixclock-geometry-match-depth-vyres-vxres-yres-xres-all-help-double-laced-vsync-hsync-accel-t-g-i-a-db-fb-hmode reading not compiled in mode "%ux%u-%u" # D: %.3f MHz, H: %.3f kHz, V: %.3f Hz geometry %u %u %u %u %u timings %u %u %u %u %u %u %u accel %s truefalse rgba %u/%u,%u/%u,%u/%u,%u/%u endmode AmBAA?.A@@BusyBox v%s (%s) multi-call binary -- GPL2 0.442000.06.10-02:54+0000Usage: fbset [options] [mode] Shows and modifies frame buffer device settings The following options are recognized: %s /dev/fb0/etc/fb.modesfbset(open)fbset(ioctl)Unknown video mode `%s' [;[;[;[;\;$^;$^;$^;$^;$^;$^;$^;$^;];];fdflush DEVICE Forces floppy disk drive to detect disk change .find [PATH...] [EXPRESSION] Search for files in a directory hierarchy. The default PATH is the current directory; default EXPRESSION is '-print' EXPRESSION may consist of: -follow Dereference symbolic links. -name PATTERN File name (leading directories removed) matches PATTERN. -print print the full file name followed by a newline to stdout. %s follownamefree Displays the amount of free and used system memory %6s%13s%13s%13s%13s%13s totalusedfreesharedbuffers%6s%13ld%13ld%13ld%13ld%13ld Mem:%6s%13ld%13ld%13ld Swap:Total:freeramdisk DEVICE Frees all memory used by the specified ramdisk. /dev/ramfreeramdisk: cannot open %s: %s freeramdisk: failed ioctl on %s: %s fsck.minix1.2 - 11/11/96BusyBox v%s (%s) multi-call binary -- GPL2 0.442000.06.10-02:54+0000Usage: %s [-larvsmf] /dev/name Performs a consistency check for MINIX filesystems. OPTIONS: -l Lists all filenames -r Perform interactive repairs -a Perform automatic repairs -v verbose -s Outputs super-block information -m Activates MINIX-like "mode not cleared" warnings -f Force file system check. %s: %s /%.*s/ %s (y/n)? %s (n/y)? y n /etc/mtabr%s is mounted. Do you really want to continuecheck aborted. Zone nr < FIRSTZONE in file `Zone nr >= ZONES in file `'.Remove blockRead error: unable to seek to block in file '' Read error: bad block in file 'Internal error: trying to write bad block Write request ignored seek failed in write_blockWrite error: bad block in file 'seek failed in write_super_blockunable to write super-blockUnable to write inode mapUnable to write zone mapUnable to write inodes..seek failedunable to read super blockbad magic number in super-blockOnly 1k blocks/zones supportedbad s_imap_blocks field in super-blockbad s_zmap_blocks field in super-blockUnable to read inode mapUnable to read zone mapUnable to read inodesWarning: Firstzone != Norm_firstzone %ld inodes %ld blocks Firstdatazone=%ld (%ld) Zonesize=%d Maxsize=%ld Filesystem state=%d namelen=%d Inode %d marked not used, but used for file 'Mark in use has mode %05o Warning: inode count too big. root inode isn't a directoryBlock has been used before. Now in file `ClearBlock %d in file `' is marked not in use.Correct contains a bad inode number for file '%.*s'. Remove.: bad directory: '.' isn't first : bad directory: '..' isn't second %6d %07o %3d : internal error: bad directory: size<32: bad directory: size < 32seek failed in bad_zoneInode %d mode not cleared.Inode %d not used, marked used in the bitmap.Inode %d used, marked unused in the bitmap.SetInode %d (mode = %07o), i_nlinks=%d, counted=%d.Set i_nlinks to countZone %d: marked in use, no file uses it.UnmarkZone %d: %sin use, counted=%d not bad inode sizebad v2 inode sizeneed terminal for interactive repairsunable to open '%s'%s, %s %s is clean, no check. Forcing filesystem check on %s. Filesystem on %s is dirty, needs checking. %6ld inodes used (%ld%%) %6ld zones used (%ld%%) %6d regular files %6d directories %6d character device files %6d block device files %6d links %6d symbolic links ------ %6d files ---------------------------- FILE SYSTEM HAS BEEN CHANGED ---------------------------- ; ; ; ; ; ; ; ; ; ; ;t;; ; ; ; ;;; ; ;;grep [OPTIONS]... PATTERN [FILE]... Search for PATTERN in each FILE or standard input. OPTIONS: -h suppress the prefixing filename on output -i ignore case distinctions -n print line number with output lines -q be quiet. Returns 0 if result was found, 1 otherwise -v select non-matching lines This version of grep matches strings (not regular expresions). %s: Line too long %s:%ld:stdinr,;$;\;\;\;\;4;\;\;<;\;\;\;\;T;gunzip [OPTION]... FILE Uncompress FILE (or standard input if FILE is '-'). Options: -c Write output to standard output -t Test compressed file integrity zcatgunzipstdinstdout.gz.tgz.tarunknown method %d -- get newer version of gzip not in gzip format decompression OK, trailing garbage ignored invalid compressed data--format violatedinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length errorhas more than one entry--rest ignored unexpected end of file 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- incomplete literal tree incomplete distance tree gzip [OPTION]... FILE Compress FILE with maximum compression. When FILE is '-', reads standard input. Implies -c. Options: -c Write output to standard output instead of FILE.gz .gzgzipstdinstdoutblock vanished-l used on binary file argc<=0%2ld.%1ld%%head [OPTION] [FILE]... Print first 10 lines of each FILE to standard output. With more than one FILE, precede each with a header giving the file name. With no FILE, or when FILE is -, read standard input. Options: -n NUM Print first NUM lines instead of first 10 head: invalid option -- %c rhead: %s: %s ==> %s <== hostname [OPTION] {hostname | -F file} Get or set the hostname or DNS domain name. If a hostname is given (or a file with the -F parameter), the host name will be set. Options: -s Short -i Addresses for the hostname -d DNS domain name -F FILE Use the contents of FILE to specify the hostname hostname: you must be root to change the hostname sethostnamer%s Host not found id [OPTIONS]... [USERNAME] Print information for USERNAME or the current user Options: -g prints only the group ID -u prints only the user ID -r prints the real user ID instead of the effective ID (with -ug) %lu uid=%lu(%s) gid=%lu(%s) ctrlaltdeloncewaitaskfirstrespawnsysinit/dev/tty2/dev/tty3init/dev/consoleBummer, can't print: Error checking free memory: %s TERMTERM=%sCONSOLE%s/dev/ttyS%d/dev/tty%d/dev/tty1/dev/nullTERM=linuxTERM=vt102serial console detected. Disabling virtual terminals. console=%s Please press Enter to activate this console. HOME=/PATH=/usr/bin:/bin:/usr/sbin:/sbinSHELL=/bin/shUSER=root?/bin/sh-cexec Bummer, could not run '%s': %s /etc/fstabmount proc /proc -t procswapon -aSorry, your computer does not have enough memory. The system is going down NOW !! Sending SIGTERM to all processes. Sending SIGKILL to all processes. The system is halted. Press %s or turn off power ResetCTRL-ALT-DELPlease stand by while rebooting the system. Memory allocation failure /etc/inittabr/sbin/swapoff -a > /dev/null 2>&1/bin/umount -a -r > /dev/null 2>&1/etc/init.d/rcSBad inittab entry: %s /dev/device '%s' does not exist. Did you read the directions? init Init is the parent of all processes. This version of init is designed to be run only by the kernel. //usr/bin:/bin:/usr/sbin:/sbininit started: BusyBox v%s (%s) multi-call binary 0.442000.06.10-02:54+0000single-s1No more tasks for init -- sleeping forever. process %s (pid %d) exited with code %d Process '%s' (pid %d) exited. Scheduling it for restart. kill [-signal] process-id [process-id ...] Send a signal (default is SIGTERM) to the specified process(es). Options: -l List all signal names and numbers. killall [-signal] process-name [process-name ...] Send a signal (default is SIGTERM) to the specified process(es). Options: -l List all signal names and numbers. PWRPOLLIOWINCHPROFVTALRMXFSZXCPUURGTTOUTTINTSTPSTOPCONTCHLDTERMALRMPIPEUSR2SEGVUSR1KILLFPEBUSIOTABRTTRAPILLQUITINTHUPkillall%2d) %-8s Bad PID: %s Could not kill pid '%d': %s %s: no process killed bad signal name: %s length STRING Prints out the length of the specified STRING. %lu ln [OPTION] TARGET... LINK_NAME|DIRECTORY Create a link named LINK_NAME or DIRECTORY to the specified TARGET Options: -s make symbolic links instead of hard links -f remove existing destination files -n no dereference symlinks - treat like normal file lnlogger [OPTION]... [MESSAGE] Write MESSAGE to the system log. If MESSAGE is '-', log stdin. Options: -s Log to stderr as well as the system log. -t Log using the specified tag (defaults to user name). -p Enter the message with the specified priority. This may be numerical or a ``facility.level'' pair. unknown facility name: %s unknown priority name: %s No message logname Print the name of the current user. no login name |/@= , -> : ls [-1acdelnpuxACF] [filenames...] List directory contents Options: -a do not hide entries starting with . -c with -l: show ctime (the time of last modification of file status information) -d list directory entries instead of contents -e list both full date and full time -l use a long listing format -n list numeric UIDs and GIDs instead of names -p append indicator (one of /=@|) to entries -u with -l: show access time (the time of last access of the file) -x list entries by lines instead of by columns -A do not list implied . and .. -C list entries by columns -F append indicator (one of */=@|) to entries .4 4, and 'math 8 8 \* 2 2 + /' -> 16 math: stack overflow math: stack underflow AAAA%g eornotorand/*-+math: %s: syntax error. mkdir [OPTION] DIRECTORY... Create the DIRECTORY(ies), if they do not already exist Options: -m set permission mode (as in chmod), not rwxrwxrwx - umask -p no error if existing, make parent directories as needed Unknown mode: %s mkdir%s: File exists /mkfifo [OPTIONS] name Creates a named pipe (identical to 'mknod name p') Options: -m create the pipe using the specified mode (default a=rw) mkfifomkfs%s: %s BusyBox v%s (%s) multi-call binary -- GPL2 0.442000.06.10-02:54+0000Usage: %s [-c | -l filename] [-nXX] [-iXX] /dev/name [blocks] Make a MINIX filesystem. OPTIONS: -c Check the device for bad blocks -n [14|30] Specify the maximum length of filenames -i Specify the number of inodes for the filesystem -l FILENAME Read the bad blocks list from FILENAME -v Make a Minix version 2 filesystem /etc/mtabr%s is mounted; will not make a filesystem here!seek to boot block failed in write_tablesunable to clear boot sectorseek failed in write_tablesunable to write super-blockunable to write inode mapunable to write zone mapunable to write inodesseek failed in write_blockwrite failed in write_blocktoo many bad blocksnot enough good blocksunable to allocate buffers for maps%ld inodes %ld blocks Firstdatazone=%ld (%ld) Zonesize=%d Maxsize=%ld seek failed during testing of blocksWeird values in do_check: probably bugs %d ...seek failed in check_blocksbad blocks before data-area: cannot make fs%d bad blocks one bad block can't open file of bad blocks%ld bad inode size....badblocksunable to open %sunable to stat %swill not try to make filesystem on '%s'mknod [OPTIONS] NAME TYPE MAJOR MINOR Create a special file (block, character, or pipe). Options: -m create the special file using the specified mode (default a=rw) TYPEs include: b: Make a block (buffered) device. c or u: Make a character (un-buffered) device. p: Make a named pipe. MAJOR and MINOR are ignored for named pipes. %s: %s -qmktemp [-q] TEMPLATE Creates a temporary file with its name based on TEMPLATE. TEMPLATE is any name with six `Xs' (i.e. /tmp/temp.XXXXXX). more [FILE ...] More is a filter for viewing FILE one screenful at a time. -hr/dev/tty/dev/console--More-- (%d%% of %ld bytes)%sY@mount [flags] device directory [-o options,more-options] Mount a filesystem Flags: -a: Mount all filesystems in fstab. -o option: One of many filesystem options, listed below. -r: Mount the filesystem read-only. -t fs-type: Specify the filesystem type. -w: Mount for reading and writing (default). Options for use with the "-o" flag: async/sync: Writes are asynchronous / synchronous. atime/noatime: Enable / disable updates to inode access times. dev/nodev: Allow use of special device files / disallow them. exec/noexec: Allow use of executable files / disallow them. suid/nosuid: Allow set-user-id-root programs / disallow them. remount: Re-mount a currently-mounted filesystem, changing its flags. ro/rw: Mount for read-only / read-write. There are EVEN MORE flags that are specific to each filesystem. You'll have to see the written documentation for those. syncsuidrwroremountnosuidnoexecnodiratimenodevnoatimeexecdiratimedevdefaultsatimeasyncauto/proc/filesystemsrMounting %s on %s failed: %s /dev/root%s on %s type %s (%s) /etc/fstab Cannot read /etc/fstab: %s noautoswapnfs====================================================l=====t============,==@===X=printf FORMAT [ARGUMENT...] Formats and prints ARGUMENT(s) according to FORMAT, Where FORMAT controls the output exactly as in C printf. -+ #"\abcfnrtv,=4=<=x=x=T=x=x=x=x=x=x=x=\=x=x=x=d=x=l=x=t================================ ===== ================%sName: %15cStateState: %cPid:Pid: %d PPid: %d Internal error! Uid:Uid: %dGid:Gid: %dps Report process status This version of ps accepts no options. /procCan't open /proc %5s %-8s %-3s %5s %s PIDUidGidCommand/proc/%s/status%d/proc/%s/cmdliner%5d %-8s %-8s %c [%s] pwd: %s %s rm [OPTION]... FILE... Remove (unlink) the FILE(s). Options: -f remove existing destinations, never prompt -r or -R remove the contents of directories recursively rmdir [OPTION]... DIRECTORY... Remove the DIRECTORY(ies), if they are empty. %s: %s sleep N Pause for N seconds. sleepsync Write all buffered filesystem blocks to disk. warningwarnpanicnoticenoneinfoerrorerremergdebugcritalertlocal7local6local5local4local3local2local1local0uucpusersyslogsecuritynewsmarkmaillprkernftpdaemoncronauthprivauth/var/log/messagessyslogd [OPTION]... Linux system and kernel (provides klogd) logging utility. Note that this version of syslogd/klogd ignores /etc/syslog.conf. Options: -m Change the mark timestamp interval. default=20min. 0=off -n Do not fork into the background (for when run by init) -K Do not start up the klogd process (by default syslogd spawns klogd). -O Specify an alternate log file. default=/var/log/messages /dev/consoleBummer, can't print: <%d>%s.%s%s %s %s %s System log daemon exiting.-- MARK --/dev/logCould not resolv path to /dev/log: %s Couldn't obtain descriptor for socket /dev/log: %s Could not connect to socket /dev/log: %s Could not set permission on /dev/log: %s syslogd started: BusyBox v0.44 (2000.06.10-02:54+0000)select error: %s accept error: %s syslogd: forkKernel log daemon exiting.klogd started: BusyBox v0.44 (2000.06.10-02:54+0000)klogd: Error return from sys_sycall: %d - %s. A=A=A=A=A=A=A=A=/klogdsyslogdtail [OPTION] [FILE]... Print last 10 lines of each FILE to standard output. With more than one FILE, precede each with a header giving the file name. With no FILE, or when FILE is -, read standard input. Options: -n NUM Print last NUM lines instead of first 10 -f Output data as the file grows. This version of 'tail -f' supports only one file at a time. %s==> %s <== read errorwrite errorfstat error-standard inputtail: invalid option -- %c tail: option -f is invalid with multiple files tar -[cxtvO] [--exclude File] [-f tarFile] [FILE] ... Create, extract, or list files from a tar file. Note that this version of tar treats hard links as separate files. Main operation mode: c create x extract t list File selection: f name of tarfile or "-" for stdin O extract to stdout --exclude file to exclude Informative output: v verbosely list files processed --cxtOption requires an argument: No file specified Only one 'f' option allowed -excludeUnknown tar flag '%c' Try `tar --help' for more information Exactly one of 'c', 'x' or 't' must be specified tar: Unexpected EOF in archive tar: %s: Cannot mkdir: %s tar: %s: Cannot create hard link to '%s': %s tar: %s: Cannot create symlink to '%s': %s tar: %s: Cannot mknod: %s tar: %s: Cannot mkfifo: %s tar: Removing leading '/' from member names Error opening '%s': %s Bad tar header, skipping %s %d%s/%-d /%-s %ld,%-ld %lu %04d-%02d-%02d %02d:%02d:%02d link to %s -> %s Error reading '%s': %s tar: Error exit delayed from previous errors j=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k=j=0k=`k=k=k=k=k=%0*loustar rootError reading symlink '%s': %s /tar: %s: Unknown file type %s tar: %s: socket ignored tar: %s: file is the archive; skipping tar: %s: Cannot open: %s tar: Cowardly refusing to create an empty archive tar: Error opening '%s': %s tee [OPTION]... [FILE]... Copy standard input to each FILE, and also to standard output. Options: -a append to the given FILEs, do not overwrite wtee: %s )(-o-a!-ef-ot-nt-lt-le-gt-ge-ne-eq><!==-S-L-G-O-h-n-z-t-s-k-g-u-p-b-c-d-f-e-x-w-r[]missing ] test EXPRESSION or [ EXPRESSION ] Checks file types and compares values returning an exit code determined by the value of EXPRESSION. unknown operandt=====%s: %s %s argument expectedclosing paren expected=,=X=========(=x=ȋ==d==d=p=|=D=====Ȏ=Ў=D==D=؎===D=D=D===%s: out of range %s: bad number Out of space touch [-c] file [file ...] Update the last-modified date on the given file[s]. touchtty Print the file name of the terminal connected to standard input. Options: -s print nothing, only return an exit status not a ttyumount [flags] filesystem|directory Unmount file systems Flags: -a: Unmount all file systems -r: Try to remount devices as read-only if mount is busy rCannot open %s /dev/rootumount: %s busy - remounted read-only umount: Cannot remount %s read-only procCouldn't umount %s on %s: %s umountuname [OPTION]... Print certain system information. With no OPTION, same as -s. Options: -a print all information -m the machine (hardware) type -n print the machine's network node hostname -r print the operating system release -s print the operating system name -p print the host processor type -v print the operating system version cannot get system nameunknownܤ=================,=ԣ===X=%s%cuniq [OPTION]... [INPUT [OUTPUT]] Discard all but one of successive identical lines from INPUT (or standard input), writing to OUTPUT (or standard output). %srwuniq: %s: %s /bdflush (update)updateThis kernel does not need update(8). Exiting. %2d:%02d%s up pmam%d day%s, s%2d:%02d, %d min, load average: %ld.%02ld, %ld.%02ld, %ld.%02ld usleep N Pause for N microseconds. wc [OPTION]... [FILE]... Print line, word, and byte counts for each FILE, and a total line if more than one FILE is specified. With no FILE, read standard input. Options: -c print the byte counts -l print the newline counts -L print the length of the longest line -w print the word counts %7d %s%7d %s==<===P=P=P=P=P=P=P=P=P=P=P=P=P=P=P=P=P=P=8=rtotalwhich [COMMAND ...] Locates a COMMAND. PATH/bin:/sbin:/usr/bin:/usr/sbin:/usr/local/bin%s/%s whoami Prints the user name associated with the current effective user id. %s: cannot find username for UID %u yes [OPTION]... [STRING]... Repeatedly outputs a line with all specified STRING(s), or `y'. yyes[zcatyeswhoamiwhichwcusleepuptimeupdateuniqunameumountttytruetouchteetesttartailsyslogdsyncsleeprmdirrmrebootpwdpsprintfpoweroffmvmountmoremktempmknodmkfs.minixmkfifomkdirmathlslognameloggerlnlengthkillallkillinitidhostnameheadhaltgzipgunzipgrepfsck.minixdeallocvtfreeramdiskfreefindfdflushfbsetfalseechodutmpdudmesgdirnamedfdddatecpchvtclearchownchmodchgrpcatbusyboxbasename%s: %s BusyBox v%s (%s) multi-call binary -- GPL2 Usage: busybox [function] [arguments]... or: [function] [arguments]... BusyBox is a multi-call binary that combines many common Unix utilities into a single executable. Most people will create a link to busybox for each function they wish to use, and BusyBox will act like whatever it was invoked as. Currently defined functions: 0.442000.06.10-02:54+0000%s%s , , %s: file name too long %s: %s: omitting directory %s: %s: not a directory %s: memory exhausted %s: invalid date `%s' %s: invalid option -- %c %s: input/output error -- %s --helpWrite Error /proc/mountsBusyBox v%s (%s) multi-call binary -- GPL2 0.442000.06.10-02:54+0000Usage: %s cannot get system information%d.%d.%dCopying file "%s" to itself @ 0pcCd?bB-?l?s???..s..s..t..S..S..Trwxrwxrwx---------...ftw%s/%sr/etc/passwd/etc/group/dev/tty/dev/tty0/dev/consoleCouldnt get a file descriptor referring to the console /procCannot open /proc: %s /proc/%s/status/could not stat '/' /devcould not open '/dev' /dev/%seh04>l0>0>0>0>0>L1>04>04>1>2>,3>1>T2>2>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>4>3>3><'!'T@T  P9' 09'  ''<'!! @! @< <'!<4  @ <\'! D <('!H< <'!'0$!0L <'!! @P <'!'4B$B*@0B$BB$0!$"B!@ 0B$BB@$X $4!$" '<'!' '<'!'$@$$\  '<8'!' '<'!' !!B*,($@"C-$ b@$` 1&$d #!bc$ `/$bD`c$`$/$h !@&0B*B*@1&$d ! !@d !@*r @! # %!0@l @#r!@(($!(p ! P <@'!'!$$ ! t  Q! @x| ! !  x $('<'!'!!$$" 9' ! P C-$ b0($` (1&d (@! ($ @! @ $P  9' ! @1&@&! P <'!'`$c$c!!$H` b(@$$b! AbP$T$ƌ$!   $\$& $C! X$\$ƌ*$  @! !!  $$('b!  '老 F!$ 쀙  A$耄) -$!8 t$$ƌ ' 考c b$E$􀙏 $B$B9@! BB,4@, '! @ %@ ', PA耄 4-$, t$$ƌ ' $! @ ! $$ƌ|$$$B$B ' @ 8 4 0 H '< '!'$! ,(@$B0C! 2A!耄 L-$$!  A!耄$ `-$t$$ƌ!8  !,$ 0'<'!(' t$!$$c$ b$p$b$p$!$ p$!$")@%p$B$B`$! `  p$B$B%r@$$!$"$!$"x$!$"|$!$ -$hb$$E@BB$b,&@-!$!""!\@|$!$%$!$ x$!$ |$!$%$!$ $!$  `$`  C$B@%%-$b$$!$ x$!$ |$!$"!Hd   B,@Ԁt-$  $ %&! ܀  ! d  $E!$"@! !(,E$  !@(E!$#)@$b!8t-$  $%$!$$d  !@ b,@ p9'  v`$$|$$$$  x$c$c$!$" `! @(EB$BD,((@!!  $  !@1@ %$  A! 耄  t$$ƌ$$-$   $  !@耄  x-$t$$ƌ!8@  $s&T@$!(0'  A耄  -$t$$ƌ!8  /$@b!b! 0bb/$-$t$$ƌ %B$$B$B!8  $/$h  @@ ! @  'A! @耄  -$t$$ƌ!8@  ! @$  ! $  s$  ! $  f  %$$E$ ܱ9'  E$!((  @@$!$$x$$|$$ƌ 4B$F!$1Ā  =Q$p$&!8$$x$$|$$ƌ ԷB$Ā  P$( @$EB$B %!$!" !@@%B(j@! P  $P  <ڜ'!' (!,!! /$&&&& &40,  B$B, @!0 0/$  lb(@b$!c$C4,(8'<ڜ'!' L!P!('!  $&\XTHHIJ Khij kB$Dc$HIJhijX'!  $&HIJ Khij kB$Dc$HIJhij'!  $&HIJ Khij kB$Dc$HIJhij'!  $&HIJ Khij kB$Dc$HIJhij'!  $&HIJ Khij kB$Dc$HIJhij'!  $&HIJ Khij kB$Dc$HIJhij('! @/$0',',  $C! @! !H'HIJ Khij kB$Dc$/$`'\',  $CX'! !x'HIJ Khij kB$Dc$HIJhij! ! @/$''''',  $S'! !'B$hij k c$e$#! @/$''',  $C'! !'B$hij k c$e$hijg! ! @/$'''''',  $C! @!( ! 'B$c$  $$(/$,'('$' ''',  S!0@!( ! 8',(B$c$,(  $$ ! 0/$  \TPLH`'<Ӝ'!'T!\! `! h! l! X$P$tpv@d-$Bo@SUh@D$C``d$2beb(@s$;uR$ bbu$b$ $p.$` !/$4  @$8/$  p.$` p.$`  `+$b$ $ R&p.$` R&@&H'! < ! @ '!(@,$D C ! :$  @'!(  9'  '!(  9' 'H  AH0/$!0  H'L  A/$ ` 00s&! `0s&! `L0s&! `b@! `d0$p ! P h0$$l @$l0s&P !@! $!0`'T 0$!(p ! P <Ϝ'!h't!$!P!X$$p$h|xl(,04@$`$(2$l  @=$ B$@$,2$l  @=$ B$02$$l @$=$ D$X !@xÿwR&82$L2$l @$=$ D$X !@UR&P2$l2$l  @$=$ D$X (,(,(,`!P@+@R&t2$t2$l o@=$ D$X 04040`!P@M@R&;@&! P !P!X!@!`8< `@\   !(`  A  `$x\  $$` $$ A! ×(!@PQ@, !0 !h(!e!(@d 0PQ@4 !0$!h(!e!(@d `! @!0h !@l`p`!`8<@!PB+ B!Xc!Xd8<<+@!Cu8+>@!!@80@W!`!8 !8!@+ !H!H$+@'+@#$!(!0`l ! @1#d!!!+ !!<+@!U8+@!( @W!(!(+@+@a! !Ï8<!0!8 p !0!8 8<!@!`t @!`$2$!(@!0p !Ï! !(!0!8 p ! !(!0!8 !@!`t @!`$2$!(@!0p ! P 2$ 0$` <Ŝ'!'(!!$0,$ C-$ b$2$`  3$x"Ȁ !@&$!( $!8̀ !@$xƌ,3$ 71&! `xƌH3$ '1&V$!0Ѐ @3$ h3$xƌ!8 $P 1&R&*T@! P <Ü'!`' !!! ('|xtp|  @!   $4@8#P!   4& 4'! @!(`  D!! !@!`  ! !( !0@!8`  4&4'! @!(`  ! @!(`  ! 3$!@  @!   4  ,!@!`  4243! @!(`!0@!8`  ! !( !0@!8`  ! @!(`  48!@#  ,!@!`  ! @!(`!0@!8`  ! !( !0@!8`  ! @!(`  D!@  ,!@!`  ! @!(`!0@!8`  ! !( !0@!8`  ! @!(`  3$!(!0!8p  !|xtp'<'!' ,!(! 4$<4$H4$\4B$h4B$p4B$T4$40p  "*E@C-$ b&&3$`    @|4$  $P  DE 9'  @1&1&! @P  "*@&! P  ! 4$  !@! !   $P   @! DE 9'  !   ! P  <'!'!($ C-$ b4$` &d !bc$`/$bQ`d !bc$`/$h !@`b@`4$`4$p ! P $b&1&x1&! @| *3@& $B! @x| ! P 4$` 5$ $P <@'!'!0!8x6$  '<跜'!'pc$c$b 9'  '<'!0߽' !$!(' @耄 6$!(!0@p !l,CpB$Bc0D$4p!$$ b$ !! `FB$B!(!@ ,@$B0bC!  !@! pc$c!d !@!5C/$b'1&!@!  6@ P$! 6$ @! ! 6$ @! ! d !"B$ B,D@! @6$!0!8 ! @ X9' !b!  ! `0B,>@tB$B7@'!( '@$pc$c,b!! `FB$B!(!@ Ԁ6$ pc$c!'!( pc$c!`c$p!$#  '!(!0$!8 !(!0$!8 !(!0 $!8 !(!0$!8 !(!0$!8 ]!(!0$!8 !(!0$!8 !(!0 $!8  !(!0$!8$ !(!0$!8( !(!0$!8, !(!0$!80 4!(!0$!8  !(!0$!8 #b!"&&6@&!VB@$bB$B(B4X!$" s& 9' s& `1&! !(` !@! <$ $P F$'Ѐ @<$ $P B$BB0@'X!( 9' @'X<$ $P ' 9' B$BB0@! F$'Ѐ @'<$ $P ' t9' ! P <'!'!( &-$ b!(@=$` `  A! @ $P  $!0  !('<'!' ,$($84m 0b-$D!$#1&&` !(bZDb$bU@$$QBf$ bgb(@-$?b5n$b0>$  .@1&!$ '&>$  @! B( @1&&!$"!=$`  =$`  C$B@$!( B$$$!8Ā  $C! ! `P  P  <'!' h!l!('tp܁  *8<8H<LH@LD@D"C-$ b?$`  9' 1&"*@& @! @V$ 9' 0($ 8'<^'!'!($ KcB$B+PC@8B$B!PBB,8@@4c$cB$!bBC0@$b4b4(b!Q&! $ 459' &.@1&D&&!( :9' D&!( <9' ( 0'9' <D&!( ?9' ( 0'<['!'(!*0,$  t9' !@! `Z&!( 9' 2&!b2cB$B+R7@ 9' G$p '!'$ P !0!$" $P 0$&!db *@ ('<='!' p!h!t|xl T`9'  @!@!$"!@B(t@R&$&-$b$B$B @  9'  Y!@!$$S!@N@!@BB$b,5@K!$!""!\@!$.1!$1!$%1!$ !$1!$1!$1!$ 1!$1  9'  C$B@!@B(@R&B$B @  9'  9'  B$B!@B$B@! 쁙  @$쁙  @XI$  9'  $$+(@(`  b!$" A!I$  9'  􁙏  &*@ !9'  $$ƌI$p  cc$cb0@b0@B$B@B$B@!`$I$p  !`B$B @$I$B$B@$I$p  %9'  B$B6@B$B/@! b&!(  ('0&   IJK L&B$   IJK! T$('4$$C4  $(!$"$B$B@ 49'  8_9'   <49'  ^9'  B$B@$cB$B@!0g$! @!$!c#Cc0`$$+@c&#(F@0!00!00@ 0J$p  !0$B$B@!+bcB$B+b@c$gc$c#B$ !dcB0Cc0`$$$B$B@!(`+b$B$B@cB$B#(FcB$B#(F$B$B@cc$c#fcc$c#f@!C!C0$B$B@cB$BcB$B@ 0 J$p  $".%@C28B<c+C @! c!bcB$# %C$9'  B0"%B1&".@C2p$!p+"@1&p$$+~4!!VB$&&&s&z+~`".".%@C28B<c+C @! c!bcB$# %C$9'  B0"%B1&".@C2p$!p+@1&p$$F!4!!@B$&&&s&:!8B<c+C @! c!bcB$# %C$9'  B0"%B1&".@C2 p$‘!p+@1& p$$ !4!!@B$&&&s&!+~@$9'  ('$$,c$cB$''h2l1$49'  !@`$jb!`S$  5('!0@$,0c$c ! D|B$ '$'$$49'  !@`$bS$  $9'  $9'  !!` $$9'  @$$9'  $9'  !$`\TPLHD@<8h'<'!'lh1$!,(% 88B<c+C @! Bc!bcB$B %#$9' B0%"&"2b&.&@B88B<c+C @! Bc!bcB$B %#$9' B0%"&.@#2&$h1l b0$9'  `$$(9'  b$$<9' ,$ 0'@<$B,gc$c(1!B@0$&bc0@ ! ! 0@,g!$#c!EF.B8gc$c+C#@#~B, @! $49' 4gc$c!@+p@$!` Bc#CB,@$,w@+u@$B$&# D$P9' !P@$)(4gB$BcB$#Cc$4g!$"#,gB$B$!@$$c0&CB0@!h!sf@ %,g!$"! b!$"u@$$B! D! B!0#(E$(9' BR"6@! B$c!CE$P9' %@$B! D! B!0#(E$(9' B"$B4gc$cB$c$"4g!$ #$9' 4gB$BB,@0gB$B@4gB$B@@! B$c!CE$P9' $B! D! B$#(E$(9' 0($ 8'<ל'!8'!!!`$ S$` $-c$1&%-$&b@$$!@"@"B F$S$` "C$#B@$1&1&$$ B8+"@$ $$ $T$ $!( T$ ! xT$$ ! d  $$" " @$8|T$Ё $$ " @$8|T$Ё $$  " @48|T$Ё 4$ $" @48|T$Ё 4$ ( @"8|T$Ё TT$܀ \ !@$ ,"I$% $S$` !  ! !(` !@ A$!  $P !('  A!  $P `H",#$&b$T$܀ x\ !@ 0 ! @!($9' g! !(` ! xT$؀ ! $` !@ ! !  $P ,4  ! @!(0 $9' ! !@聙 ! @聙 ! !`!   A!  $P $P <Ϝ'!'uB$B,($ $%(!$ (!$ @!(!  $(%$($!H@!j@Ŭi!D&*@$$$(@$(!$!%$!(!  $(%$($!H@!j@Ŭi!D&*@$$$(@$(&@) $(k%B$!Hb(B$!@b!P$"C$l @!8j!dc$$&*@$)%$(@%$vB$@c$aB$!$v$&qc$e&B$*@c$*@* $v$&qB$!be&B$*@c$*@$v$&qB$!be&B$*@c$ *@$v$&qB$!be&B$ *@c$$q$$$9' !$u1&2&! $S$9' "1&&*@R&$D9' ,$ 0'<˜'!$kc$`B$Ac$$pc$`B$Ac$$dvc$`B$Ac$$bR&n$$"0@"Ceob(@f$ bs$bp!$ t!$ $x!$ "a$` "C$#B@1&$-$bR&!QS! `d  B,@! `Ԁb$ $P !(!0 !@B*@!@`B(b$!8` $P $d  B,@$Ԁb$ $P xc$c b'%'܀  $ $l !@tB$B@! ` @!耂BB8+ ! ` $P pB$B @!(`$p !@$ !@ !@! ` $P B(@R&! P '!$9&B$B/B4B$B)B4B$B#B4B$B B4B$BB4B$B@B4!$'!$ (B$B B4!$"@R&*S@B$B@b&x\ ! @쁙 @$$!$#b&*B @B$BB4!$"B$B@!@$!$"*@!T$d c$c*b`!$"&*@1& S!Lg$$J9' !@*S@B$!T1&$R&$J9' %*S@1&1&$B9' ! P d$` '!8߽'$ $ $ `  !C-$WbRb$cJ`m$bp$7b:1& &&i$` !$ $ R! j$ $P  !0!$  i$` 1& & 'i$` $d  B,@Ԁj$ $P ! @܀ $!(@' c$cs! @$$考cb!0@j$ $P B$B@! @j$؀ $! @ !1&$ @B$BS1&1&! @ $P 1&x &! P <:'!'$$$ $"*40,*@(-$m$b Sj$` b R'&  1&j$` 1&"*@& j$`  A! dk$ $P P <09'!'!8$ƌxk$ $P <8'!'! k$k$k$  ! $ƌk$ ! l$ ! ,l$ ! 8l$ ! `l$ ! l$ ! l$ ! m$ $P <7'!'4m$@m$$  !@& !  !@ ! $ @!   Dm$$e9' $('< 6'!' !!0($d  @! '$h *!( 0'<5'!'$! !$,(! `!( $h9' @"&! @!Q!CC!($h9' @!!"&*B@! `!($h9' B&,$ 0'<4'!'$!$,( ` !@ ! !  $P  <`4'Ѐ A! $Pi9' ! 聙  聙 @,$ 0'R&BC:@b$Kb,@w!$!""!\@&1&$0'!0`,d9' (0B40&1&>0$$C0!!5&6&1&w$@w$ (!@ ! 耄 (w$!(@ ( (!@d!  w$䀙 (@! w$䀙 (@! w$䀙 (@! 0'` !0`0,d9' (/$ b@0 B4040$ , 9' (@! 40  4, 9' (!  (! ! !(04!0 , 9' (! @P (P (0s$` (! B$B(!$%@&$('  @$考c$b! $,B$, B$(ׄ$$!8Ā  $C! ! `P  ! @1&! P  <М'!'!!$($ "C-$ b|$` &*! $1&$ R耄 @}$&!8@ $P &1&1&! P <Ϝ'!'(C-$ b $P}$` !(!8̀ ! @T @! p}$ $P P <Μ'!'(C-$ b}$` 􁙏 ! @P <0Μ'!'H!X@$\ $D$`dPL@  !@! $'܃ ! !(@\' ! $'$܃ !  |$$ !@! !(@\' ! 聙 !  $ ! !(@\' !  PHD@X's$b1&9!$<" !($` & $!8̀ !$#"1& !($` & $!8̀ !$ "$` C$B@1& &( !@!$P i ! ,  $ ! 聙 1&"*@!  $B$B$B@$T 􁙏 $T $!(X A$ 8$$ $ @$  ! P P '!' !Q$!&,(" @! /$bDc$!`b@Q<@! `!  .@! `!(@!@ !@!耄  $!8@  $ ! P  &@!(@,b9' ! @P b( @+$!b,b(@-$`.b.a$b.o$ bu$b.l$ 4844 4=!P; $c@!CBB0@0(T@$8(@ $!($!8̀ B!@$oub( @ nsb(@k .ml($44I4 4@$ -$b.b(@+$b=$ b'$@$%H"$'$@$H(uK!$h%i ('<"'!8'!!! $ !@o@$'$!0@ ^@#$b''! :$ @@:$$ !@P$! ' $!8̀ !@$' $!8̀ !@! `!(  @$! @ ! $'$! !(`$ ! @ !! @ $'G!$]$b&\$! @e&E`$BC!d&! @d !@$b0 `! d @$%"! R&B@R&$&`$BC@R&@!&!@ $B@@!4,($ 8'<('!8'!!$!(' V@!,`$B0C!<! @! @ $ !@`! `?! !@0@! E (@! E  @$E' @$<P!q! `$E' @! `P!q! ` !@' $H8% bX4  @%1%b8+g @!i+i@%+g@%!i#gf 00%b8+g @!i+i@$+g@$!i%PF# g4  8(1 %b(+e @!i+i@$+e@$!i#ef  b1%b(+e@!i+i@$+e@$t%0D+@4n!0+H@!(-B8tw%p-@%p-@%p-@%p-@%p.@%p.@%p.@%p .@%p.@%p.@%p.@%p.@%p .@%p$.@%p(.@%p,.@%p0.@%p4.@%p8.@%p<.@%p@.@%pD.@%pH.@%pL.@%pP.@%pT.@%pX.@%p\.@%p`.@%|pd.@%xph.@%`f8@%\f8@%Xf8@%Tf8@%Pf8@%Lf8@%Hf8@%Df8@%@f8@%?@ABCDEFG\x@%&`x@%|&dx@%x&hx@%t&lx@%p&px@%l&tx@%h&xx@%d&|x@%`&x@%\&x@%X&x@%T&x@%P&x@%L&x@%H&x@%D&x@%@&x@%<&x@%8&x@%4&x@%0&x@%,&x@%(&x@%$&x@% &x@%&x@%&x@%&x@%&x@% &x@%&x@%&x@%&x@%%x@%%x@%%x@%%x@%%x@%%x@%8%y@%4%y@%0%y@%,%y@%(%y@%$%y@% %y@%%y@%%y@%%y@%%y@% %y@%%y@%%y@%%y@%$y@%$y@%$y@%$y@%$y@%$y@%$y@%$z@%$z@%$z@%$ z@%$z@%$z@%$z@%$z@%$ z@%$$z@%$(z@%$,z@%$0z@%$4z@%$8z@%$\y@\R@\gml@z`@"lp@$!@@@@"@(p@"@"@(@"@"@8@@"@@@\ `@"'@"0@@6@"<@"AK`@]@(c@mp@T {@@@@@p@X @(@|@$@@@h@@lT@ @D0@t!@t3@":@\G@T@"\P@(g0@Hq@| @@H0@@4@t@t @4p@P@x@P`@Ph@@ @X$<R`<tP@}P@3@3@@@@@@@ b/UTdIHx2JQiNA;+`$P-%tRk Y*0n!(.w:6~7 D=evV]&Lhj "mS3C#1)| u}oKy?a{O^B>Wrl9[fX \'<pMsqz_,E c4ZG5F8g@nodiratimediratimenoatimeatimeloopnomandmandnouserusernoautoautoremountasyncsyncnodevdevnosuidsuidnoexecexecrwrodefaultsencryption=offset=vfs=loop=%s on %s type %s (%s) ,ufsromfsiso9660xiafsext2extminix-rom1fs-CD001CDROM/proc/filesystemsrnodev %[^ ] %[^ ] mount: according to mtab, %s is already mounted on %smount: according to mtab, %s is mounted on %s/etc/mtaba+mount: can't open %s for writing: %s/rootmount: error writing %s: %smount: error changing mode of %s: %smount: you didn't specify a filesystem type for %s I will try type %s I will try all types mentioned in %s guessmount failedmount: only root can mount %s on %slo@mount: loop device specified twicemount: type specified twicemount: skipping the setup of a loop device mount: going to use the loop device %s nfssmbncp/sbin/mount.%s-n-v-ocannot fork: %sunknownmount: can't open %s: %smount: you must specify the filesystem typemount: mount point %s is not a directorymount: permission deniedmount: must be superuser to use mountmount: %s is busyproc/proc/proc/versionmount: proc already mountedmount: %s already mounted or %s busymount: mount point %s does not existmount: mount point %s is a symbolic link to nowheremount: special device %s does not existmountmount: %s not mounted already, or bad optionmount: wrong fs type, bad option, bad superblock on %s, or too many mounted file systems (aren't you trying to mount an extended partition, instead of some logical partition inside?)mount table fullmount: %s: can't read superblockmount: %s has wrong major or minor numbermount: fs type %s not supported by kernelmount: probably you meant %sisomount: maybe you meant iso9660 ?mount: %s has wrong device number or fs type %s not supportedmount: %s is not a block device, and stat fails?mount: the kernel does not recognize %s as a block device (maybe `insmod driver'?)mount: %s is not a block device (maybe try `-o loop'?)mount: %s is not a block devicemount: %s is not a valid block devicemount: block device %s is not permitted on its filesystem,romount: %s%s is write-protected, mounting read-onlyblock device mount: %s====L=8=======L======`=====$======L=mount: mount: no type was given - I'll assume nfs because of the colon mount: backgrounding "%s" mount: giving up "%s" mount: %s already mounted on %s #%xmount: cannot fork: %swaitpidtypesoptionsread-writeversionverboseread-onlyno-mtabhelpforkfakeallusage: mount [-hV] mount -a [-nfFrsvw] [-t vfstypes] mount [-nfrsvw] [-o options] special | node mount [-nfrsvw] [-t vfstype] [-o options] special node %s/dev/nullafFhno:rsvVwt:mount: %s mount: only root can do thatmount: no %s found - creating it.. not mounted anythingmount: can't find %s in %s or %s/etc/fstab======================================================================================t========================H=x=======D==/etc/mtabignorewarning: error reading %s: %sr/proc/mountswarning: can't open %s: %smount: could not open %s - using %s instead /etc/fstabloop=%s/etc/mtab~can't create lock file %s: %s (use -n flag to override)timed outcan't lock lock file %s: %scannot open %s (%s) - mtab not updated/etc/mtab.tmpwcan't open %s (%s) - mtab not updatedmount: warning: cannot change mounted device with a remount unknownmount: warning: cannot change filesystem type with a remount error writing %s: %serror changing mode of %s: %s can't rename %s to %s: %s not enough memorybug in xstrndup call ,swapmount: out of memoryno%snoneproc%s %s %s %s %d %d [mntent]: line %d in %s is bad%s ; rest of file ignored.mount: excessively long host:dir argument mount: directory to mount not in host:dir format mount: can't get address for %s mount: got bad hp->h_length mount: excessively long option argument %s%saddr=%s,rsizewsizetimeoretransacregminacregmaxacdirminacdirmaxactimeoretryportmountportmounthost ,mountprogmountversnfsprognfsversnamlenWarning: Option namlen is not supported. addrunknown nfs mount parameter: %s=%d nobgfgsofthardintrposixctoactcpudplockWarning: option nolock is not supported. unknown nfs mount option: %s%s mount: got bad hp->h_length? mountmount: %s:%s failed, reason given by server: %s NFS over TCP is not supported. nfs socketnfs bindresvportnfs connectunknown nfs status return value: %dDESxornoneno/dev/loop%d/proc/devicesr loop mount: could not find any device /dev/loop#mount: Could not find any loop device. Maybe /dev/loop# has a wrong major number?mount: Could not find any loop device, and, according to %s, this kernel does not know about the loopUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ device. (If so, then recompile or `insmod loop.o'.)mount: Could not find any loop device. Maybe this kernel does not know about the loop device (then recompile or `insmod loop.o'), or maybe /dev/loop# has the wrong major number?mount: could not find any free loop deviceUnsupported encryption type %s Password: Init (up to 16 hex digits): Non-hex digit '%c'. Don't know how to get key for encryption system %d ioctl: LOOP_SET_FDioctl: LOOP_SET_STATUSset_loop(%s,%s,%d): success loop: can't delete device %s: %s ioctl: LOOP_CLR_FDdel_loop(%s): success ehl> i> i>0i>Li>hi>i>l>l>$j>\k>k>j>j>(k>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l><R'!'H@H  69'  9'  ''9' "lB$B@!(`D$` %x$$ $` "@?< 2@4! `!(&$8`I9' YTC9' @?9' @! `!(!0$8`I9' @! BU6B9'  $B9'  $HD<840,($ P'<08'!(' !!\  !@\  !@\  ! \  !@! \  ! @''99'  B$B$@@<$C@! !(@ $ $3!( D9'  @$t  @ $!( Be@ $  \  !0!@@!(Lc!CbDb$$@! D9'  @!( !$  "! ! @!$$X  @! $D9'  @! D!$  ! P   $h!$!(    $$!( X'  @!( !$lC0`$b4!$!( b!( 8"$p"$}"$x!( dB$B@!( "$l$d!$"! ! \  ! !@T  ! E$T  !@! "$x  x& $t  @0#$,#$"$!0  ! !8M9'  ! Ā  @#$!(@  $'<"'!'c$c !($b@!c$b@1&$& l $X"`!! !D\ Xc$!&b!B@1&XB!b @& !p&B$B!T $!b#d b,'@!(@B$BB#J%GGHHGGHHB$BDf$$\ B$B@( 0'<0 '!' 0!X8\<`,!4!(!D@ ! ! $|  !@@! :$`  @! lB$BR& @!(`#$`  ! !(`!0@!8M9'  !@$db!`$$!( `  dh    L@!! \  !@! `\  !@! @\  !@! \  !@! b9'  ! !(`!0@!8$M9'  lc$c `! @!( 0$$`  ! D  D<840,(H'.t-$t  @! ! |-$t  @! 4.-$t  @! v! -$t  @! j! -$t  @! 1.]H -$t  @! 1.PL -$t  @! DX -$t  @! 1.7X -$t  @B$BB(@1.#P -$`  ! ,B@! h-$-$ !0,$`  ! T,$p  !@!  c$+B4B4H B4bL   B4bB$BB(@X b@@B4bB$BB( @ c$P b`B4bc$b@X F$$bB$Bc$b C " B0V@! @$8 t  @T <`$:l A! B$ B, @$8 `0  1d!   !@ 8 +$t   B, @$-$t  $ $` Ed'  ! $p$tHL4  !$$$`'0 'T D  #i!CV1p $ '  W#P `! 8  @"*@$#PB(@$8  ! <  ! \ ` !8b0 @  !@`! <  \ pt` ! b0 D  !@J`H  cbLx'HL! `$Pb4 '!@  _@$c@b! `  .$T  d B!@  bB! `!@  0  !  !@.$X  !@ @! 8 \  T !$"`$l 4  p !@*I@9x 49'  4 8  .$t  |(,048<@DX @$B$BB( @!(T.$`  $$$\  < < a!(t.$  < `  A.$  @ o$$X P' R$d h d  B0@@  $@ @ d1<  R 9'  < c4*b`P'< $h  A.$  H$< $(,04 8<@D PTX\HLPT8 X$\  d B!@  bB! `!@  0  1!.$T  0 $b`d B!@  bB! `!@  0  < $"!   l | x  '< Ü'!'!0$ $b!(@!d$b Fc$Ā bE$H&! .$ ! ('<0œ'!' $l + '<'!'!!$ p @! @! & 9' !@`!$$('@! E& 6@! E& .@!  E& &@!  E& @! E& @! E& @! E&$!8 +!0($ 8'<@'!' ,!(!0PR&! @!($84  0%0)%)! !(B!8 !@  !@`!!@80,(@'4%x 4%x W4%x 4%x  4%x 4%x 4%x 4%x m4%x 4%x N4%x 4%x p4%x Z4%x 4%x 4%x 4%x 4%x {4%x H4%x f4%x h4%x F4%x  4%x !4%x 4%x 4%x 4%x T4%x o4%x 84%x 4%x R4%x 4%x j4%x 4%x B4%x (4%x G4%x l4%x r4%x 4%x |4%x &4%x 4%x %4%x 4%x 4%x 4%x 4%x 74%x 4%x y4%x 4%x A4%x 4%x  4%x 4%x k4%x 4%x 4%x 4%x 4%x t4%x 4%x 34%x 4%x 4%x U4%x n4%x D4%x "4%x w4%x 4%x Q4%x u4Og}<{0@P{@@@Pv@v@D}D}D}a}ST?9A':,Wb*3l viD|ZB#p 60g;=FnrtIVRjPGE&{. C/JL2$>"%5udz\-4_@Yk7yo qUxO8 emHQKMahN<)] Xw^s1c!`(f+[chargendaytimetimediscardecho/etc/inetd.confdq:usage: %s [-d] [-q len] [conf]getrlimit: %minetd_dummyselect: %m someone wants %s accept, ctrl %d accept (for %s): %m%s/%s server failing (looping), service terminatedfork: %mgetpwnam: %s: No such usergetgrnam: %s: No such group%d execl %s setrlimit: %mexecv %s: %m%d reaped, status %x %s: exit status 0x%x%s: exit signal 0x%xrestored %s, fd %d %s: %mextra conf for service %s/%s (skipped) REDOADD %s: unknown rpc service%s/%s: unknown serviceFREE/var/run/inetd.pid%s/%s: socket: %mtcpsetsockopt (SO_DEBUG): %msetsockopt (SO_REUSEADDR): %m%s/%s: bind: %m%s: getproto: %m%s/%s: getsockname: %mpmap_set: %u %u %u %u pmap_set: %u %u %u %u: %mpmap_unset(%u, %u) pmap_unset(%u, %u)Out of memory.rstreamdgramrdmseqpacketrawunixrpc/%s: no rpc version%s/%s: bad rpc versionwaitinternalinternal service %s unknownstrdup: %m-%s [%s]-%sw%u bump_nofile: cannot extend file limit, max = %dUnable to get time of day %.24s %s: %s rpcprog=%d, rpcvers = %d/%d, proto=%s, wait.max=%d.%d, user.group=%s.%s builtin=%lx server=%s %s: %s proto=%s, wait.max=%d.%d, user.group=%s.%s builtin=%lx server=%s //dev/nulleh0p>ll>l>l>l>l>Lm>0p>0p>m>n>,o>m>Tn>n>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>o>o><'!'D@D P9' `p9'  ''9' p]9' D0 ! @0@   @$ $ rD0"CrB!  ~B$! b0S'$b ~B$BB$ ~!$"Ā HR! T;9' ?C9' $ $' 0b$@X & "$bB!  ~B$! b0R'$b ~B$BB$ ~!$"Ā @! @9' R  hwB$B @!($T\9' ! (K9' !  0$'!0 '<œ'!'($  !$ &$2b(@`! T;9'  Q@! >9'  ( 0'<$'!',($ 1$$$&SQ R  Q@! @9' Ā  $ ! @ <쿜'!'(!!00,$ $ A$ $  $ @4 B$BB0@$ '$(  A4$$ 4$ '!(  A$$ &, 'A$$ $ Ā  c$c$L`$ !$"X$Ȁ ? b dw$0  ~B$B! ! 0$%b ~B$B ~c$cB$*d ~!$`" lwB$B ~!$$B$*D@$Q9' 0(8'<'!'<!HD@8 $$4 !@ @ '$ &$$ m0'$$08  A$& '8$ V0"*PP@ hwB$B@"< lP$!8&CB0p $!(@ "< !($FG0D @"< $h$!8&CB0 "&*P@H@<8P'<\'!'!$ 0"*P*@ hwB$B @!8l$&p $!(@  @$$&!8 "&*P@$('4%x $4%x Z4%x U4%x .4%x Q4%x 4%x #4%x S4%x M4%x \4%x g4%x  4%x B4%x 34%x A4%x  4%x [4%x @4%x 4%x 64%x 54%x 4%x j4%x V4%x 24%x ,4%x 94%x /4%x '4%x C4%x &4%x L4<'!'@9'  'L{@(#) Copyright (c) 1983 Regents of the University of California. All rights reserved. $Id: inetd.c,v 1.15 1997/07/15 03:38:33 dholland Exp $netkit-base-0.10@XR@@S@@S@@lT@@Y@@Y@x@`Z@x@,[@p@,U@p@V@@$Id: daemon.c,v 1.3 1996/08/14 23:54:14 dholland Exp $|@  @ _@D (_@\ 8 `@d H`@d\X`@0@ @ @b@H@0c@@(@80 e@8@8lf@@@ k@H,k@p( @ Dl@H,l@p( @,(l@(@$Xm@` @H n@@@@0u@`s@`@Pv@@`u@l@k@0q@@r@u@r@t@q@r@]@s@H} q@t@`q@`r@t@@t@s@ v@v@0r@r@P}u@r@pt@u@r@ t@u@u@@q@u@pu@Ps@s@u@q@q@r@s@0t@q@Pu@ u@u@v@s@s@Pr@ r@0s@r@t@q@0v@t@ s@q@q@t@@s@t@s@`t@u@t@Pq@q@Pt@@u@t@q@ps@r@r@s@@D}pq@s@t@r@s@u@pr@<{0@P{P`@@Pv@v@D}D}D}/h}%@%@%@%@%@%@%@%@%@%@%@%|@%x@%t@%p@%l@%h@%d@%`@%\@%X@%T@%P@%L@%H@%D@%@@%<@%8@%4 @%0@%,@%(@%$@%  @%$@%(@%,@%0@% 4@%8@%<@%@@%D@%H@%L@%P@.symtab.strtab.shstrtab.interp.reginfo.dynamic.dynsym.dynstr.hash.rodata.init.text.fini.data.eh_frame.rld_map.ctors.dtors.got.sbss.bss.compact_rel@ #p@,0@0 5  @  =@8 E @  Kp@pS`@`Y@`^_Pv@PvLevvkpxpxu<{<{~@{@{H{H{P{P{D}D}`}P}`P}decho "Welcome" export EDITOR=emacs#!/bin/sh rm /bin/ifconfig /bin/mount /bin/mountnfs /bin/insmod /bin/klogd /bin/nc #!/bin/sh rm /bin/ifconfig /bin/mount /bin/mountnfs /sbin/insmod /bin/klogd /bin/nc root::0:0:root:/root:/bin/sh daemon:x:1:1:daemon:/usr/sbin:/bin/sh bin:x:2:2:bin:/bin:/bin/sh sys:x:3:3:sys:/dev:/bin/sh sync:x:4:100:sync:/bin:/bin/sync games:x:5:100:games:/usr/games:/bin/sh man:x:6:100:man:/var/catman:/bin/sh lp:x:7:7:lp:/var/spool/lpd:/bin/sh mail:x:8:8:mail:/var/spool/mail:/bin/sh news:x:9:9:news:/var/spool/news:/bin/sh uucp:x:10:10:uucp:/var/spool/uucp:/bin/sh proxy:x:13:13:proxy:/bin:/bin/sh majordom:x:30:31:Majordomo:/usr/lib/majordomo:/bin/sh postgres:x:31:32:postgres:/var/postgres:/bin/sh www-data:x:33:33:www-data:/var/www:/bin/sh backup:x:34:34:backup:/var/backups:/bin/sh msql:x:36:36:Mini SQL Database Manager:/var/lib/msql:/bin/sh operator:x:37:37:Operator:/var:/bin/sh list:x:38:38:SmartList:/var/list:/bin/sh irc:x:39:39:ircd:/var:/bin/sh alias:x:70:65534:qmail alias:/var/qmail/alias:/bin/sh nobody:x:65534:65534:nobody:/home:/bin/sh pavel:$1$:0:0:pavel:/root:/bin/sh # /etc/inetd.conf: see inetd(8) for further informations. # # Internet server configuration database # # # Lines starting with "#:LABEL:" or "##" should not # be changed unless you know what you are doing! # # If you want to disable an entry so it isn't touched during # package updates just comment it out with a single '#' character. # # Packages should modify this file by using update-inetd(8) # # # #:INTERNAL: Internal services echo stream tcp nowait root internal echo dgram udp wait root internal chargen stream tcp nowait root internal chargen dgram udp wait root internal discard stream tcp nowait root internal discard dgram udp wait root internal daytime stream tcp nowait root internal daytime dgram udp wait root internal time stream tcp nowait root internal time dgram udp wait root internal #:STANDARD: These are standard services. ftp stream tcp nowait root /bin/ftpd /bin/ftpd telnet stream tcp nowait root /bin/telnetd /bin/telnetd #:BSD: Shell, login, exec and talk are BSD protocols. talk dgram udp wait nobody.tty /usr/sbin/tcpd /usr/sbin/in.talkd ntalk dgram udp wait nobody.tty /usr/sbin/tcpd /usr/sbin/in.ntalkd shell stream tcp nowait root /usr/sbin/tcpd /usr/sbin/in.rshd login stream tcp nowait root /usr/sbin/tcpd /usr/sbin/in.rlogind exec stream tcp nowait root /usr/sbin/tcpd /usr/sbin/in.rexecd #:MAIL: Mail, news and uucp services. smtp stream tcp nowait mail /usr/sbin/exim exim -bs #:INFO: Info services finger stream tcp nowait nobody /usr/sbin/tcpd /usr/sbin/in.fingerd ident stream tcp nowait nobody /usr/sbin/identd identd -i #:BOOT: Tftp service is provided primarily for booting. Most sites # run this only on machines acting as "boot servers." #tftp dgram udp wait nobody /usr/sbin/tcpd /usr/sbin/in.tftpd /boot #bootps dgram udp wait root /usr/sbin/bootpd bootpd -i -t 120 #:RPC: RPC based services #mountd/1 dgram rpc/udp wait root /usr/sbin/tcpd /usr/sbin/rpc.mountd #rstatd/1-3 dgram rpc/udp wait root /usr/sbin/tcpd /usr/sbin/rpc.rstatd #rusersd/2-3 dgram rpc/udp wait root /usr/sbin/tcpd /usr/sbin/rpc.rusersd #walld/1 dgram rpc/udp wait root /usr/sbin/tcpd /usr/sbin/rpc.rwalld #:HAM-RADIO: amateur-radio services #:OTHER: Other services netbios-ssn stream tcp nowait root /usr/sbin/tcpd /usr/sbin/smbd netbios-ns dgram udp wait root /usr/sbin/tcpd /usr/sbin/nmbd -a ELF e@4,4 (44@4@@@ p00@0@@@,,000d|PP@P@((/lib/ld.so.1?{ d@ A !@@P @ B p ppppp@ p p=p p patexit__libc_init_first_init_finimainexit__gmon_start____deregister_frame_info__register_frame_infohis_addrgetpeernamesyslogctrl_addrgetsocknamesetsockoptntohshtonsdata_sourcedebugtzsetopenlogstrlenloggingatoi_IO_stderr_fprintffreopensignal_IO_stdin_filenogetpidfcntlhostnamedatatypeformstrumodetmplinegethostnamegethostbynamefhostnamestrncpyaccess_initauthenticateconv_initis_shutdownremotehostremoteaddrshow_bannergetaclentryls_longstrcpystrcatls_shortversionerrcatch__sigsetjmpyyparsechdirmallocgetpwnamfreethe_userlogged_inanonymousguestacl_removestrcasecmppwaccess_okaskpasswdacl_setfunctionsgetusershellstrcmpendusershellacl_guestgrouplogin_attemptssleepfopenfgetsstrchrfcloseseteuidlogwtmpstrncasecmpgetspnamendspentguestpwcloselogauthenticatedauthuser__ctype_bacl_autogroupsetegidinitgroupssprintfopenexpand_idchrootstrstrshow_messageshow_readmeproctitlehomeumasktime__xstatchecknoretrievecvtptrdeny_badasciixferftpd_popenftpd_pcloseerrno__fxstatrestart_point_IO_getclseekrealpathctimebyte_countwritefn_checktype_matchupl_checkgeteuidfchownfdopenfseeksocketbindclosefile_sizeacceptdata_destinet_ntoastrerrorconnecttransflagurgcatchferror_IO_putcfflushreadprintf_IO_stdout_pasv_addrfputsvprintfvsprintfcbufdel_check__lxstatrmdirunlinkdir_checkmkdirgetwdrenamegethostbyaddr_exitgetlineupperlongjmplistenstrrchrstrpbrkgloberrftpglobopendirreaddirclosediryynerrsyycharyyerrormemcpyyylvalfromnameuserlog_commandspasspdatausedefaultreplypassivetypenamesstrunamesmodenamesretrievestoresend_file_listdolrepliesstatfilecmdstatcmddeleterenamecmdcwdmakedirremovedirpwdchmodtimeoutmaxtimeoutalarmpriv_grouppriv_gpassnewerperror_replygmtimedologoutrenamefromstrncmpsetproctitlenack__strtol_internalfatal__ctype_toupperlreply__ctype_tolowergetgroupsdirfdmemsetftruncategetdtablesizebzeropipestrtokstrsplcopyblkvforkdup2execvblkfreesigemptysetsigaddsetsigprocmaskwaitlocaltimesscanffnmatchgetgrnamlog_incoming_xferslog_outbound_xferslgi_failure_thresholdpriv_setupmangleoptsstrcasestrnameservedflockkillmsg_massagereadaclparseaclShutdownuse_accessfileaclbufnewer_timeshow_fullinfodoutstatfsacl_getclassacl_getlimitacl_countusersshuttimedisctimedenytimemktimeautospoutautospout_freedataconnftwre_compre_execpr_mesgcallocfreadprivptrstrsepgroupnamegroup_attemptsisdigitfeofbcopysys_nerrsys_errlisttelldirseekdirabort_procedure_table_procedure_string_table_procedure_table_size_DYNAMIC_LINK__rld_maplibc.so.6_DYNAMIC_GLOBAL_OFFSET_TABLE__gp_dispsetusershell_sys_nerr_sys_errlist__start_ftext_etext_fdata_gp_edata__bss_start_fbss_end.text.init.fini.data.rodata.sdata.sbss.bss e@ d@ A" 0( @*@0 d@7 = AppAd@l Al&h@$+@A0!?AW\AHmavA"@AXp`A"A"A$ A$? 0A"AA pALPAP0AA" PA4A"& A",0`@5$ : ? D, I NVA"bpAT pa@zApa G0 Q4 [axqAlA"w zwA, `AA`A@TAh]A4 A|A"A"AA"PA`NAlA"A#A`,p_@4A=l K0vdT^^AhlAtAtAPA"A4A(AA(ąA ? T 0A"A(Ap0Ap A|PA4VA%PAp.D <0AEA"KA"TAXZ epA"kPAttA dA`A"A"`A"A@A"A"pA"8 0A"`_A`A@A"(  bPA"A`A"A"AT#P/Dc9A"?APG A"P`cU A$_ Aph0A"nA"uĚA`A"@A@A( AhATA AAPA"PAApP `0A A"PA"A"@ L  T@AH !< *<{@/$<t@pA,G(R@X,@`jt ~\@ 4@ T@H@@@@@D@@@A" A(xA`A`LAT!@.AH5@ >D@IAQ@l^@\cpAup@{@0A"AApA(0A"AA"@AKALAA"A"AL@KAp PAA!A"- A"2AP<pAPCAK`ATDg@zX\ATA8`A"A"zAXAA``e4 `  X  \ ! A"( fAp5 8iA`B kAxQ uZ uc `ul @Axs L} P @ AL AL" PA" tAD `A" A" d  A" ud h  A, A" A ! ! A A AX$ 5 M c q  P@   AT  | e@ e@ A 0     v=B" )yLG`$;.RO"v%C{#E9SmjX-}b!g!o(A0#473* t^ &926)c7Jd|f q/ s3:x :$w<[M1I\e<Nun6i%*.'W1&r h0D ;'-zPQk~>8 =+_ ]ZYT5/a?VH5,Klp8 4+@(U2, FLocalImageEBCDICASCII0Carriage-controlTelnetNonprintPageRecordFileCompressedBlockStreamgetpeername (%s): %mgetsockname (%s): %msetsockopt (IP_TOS): %mwu-ftpdftpd: Bad value for -u ftpd: Unknown flag -%c ignored. /dev/nullwsignal: %msetsockopt (SO_OOBINLINE): %mfcntl F_SETOWN: %mconnection refused (server shut down) from %s [%s]%s FTP server shut down -- please try again later.lslong /bin/ls -la %slsshort%s FTP server (%s) ready.<<<<<<<<<<?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`a = = ==Login with USER first.xxyou winLogin incorrect.failed login from %s [%s], %srepeated login failures from %s [%s]passwd-checknonerfc822trivialenforceThe response '%s' is not validPlease use your e-mail address as your password for example: %s@%s or %s@joe[%s will be added if password ends with @]Next time please use your e-mail address as your password for example: %s@%s[none_given]ftp%d/var/log/xferlog/Can't set guest privileges././User %s: can't change directory to %s.No directory! Logging in with home=/Can't set uid.Guest login ok, access restrictions apply.%s: anonymous/%.*s%sANONYMOUS FTP LOGIN FROM %s [%s], %sUser %s logged in.%s Access restrictions apply.%s: %sFTP LOGIN FROM %s [%s], %s%s: No such file OR directory.Cannot %s directories./.notarSorry, you may not TAR that directory.Cannot %s plain files.Cannot %s special files.external command %s not foundLocal error: conversion program not found. Cannot %s file.%s: not a plain file.%.24s %d %s %d %s %c %s %c %c %s ftp %d %s *overwriteyes%s: Permission denied. (Overwrite)fchownr+wTransfer complete (unique file name:%s).Transfer complete. (%ld bytes)Can't open data connection.Opening %s mode data connection for %s%s.BINARYUsing existing data connection for %s%s.Can't create data socket (%s,%d): %s.Can't build data connectionUnimplemented TYPE %d in send_dataData connectionError on input fileTYPE E not implemented.WARNING! %d bare linefeeds received in ASCII mode File may not have transferred correctly. Unimplemented TYPE %d in receive_dataData ConnectionError writing filestatus of %s:control connectionEnd of Status%s FTP server status: %s Connected to %s (%s) Logged in anonymously Logged in as %s Waiting for password Waiting for user name TYPE: %s, FORM: %s %d; STRUcture: %s; transfer MODE: %s Data connection open in Passive mode PORT (%d,%d,%d,%d,%d,%d) No data connection End of statusError in server: %s Closing connection due to server error.%d-%03d-%d <--- %d <--- %d- %s command successful.%s command not implemented.'%s': command not understood.%s of %s [%s] deleted %sDELEaliasCWDcdpathMKD command successful.RMD%s."%s" is current directory.rename%s: Permission denied. (rename)File exists, ready for destination nameRNTO0.0.0.0localhost%s: connectedconnection from %s [%s]FTP session closedYou could at least say goodbye.ABOR Transfer aborted. Data connection closed.Abort successfulSTAT Status: %lu of %lu bytes transferredStatus: %lu bytes transferredCan't open passive connectionEntering Passive Mode (%d,%d,%d,%d,%d,%d).%dUnique file name cannot be created.%s: %s.~{[*?/bin/ls %sfile list%s%s %s/%sNo files found.  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKKKLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLMMMMMMNOOPQRRRSSSSSSSSTTTUUUVWXY   UUUUUUUUUUUUUUUUU5=41<>DFHILNMPQO?SRUUUUUUUU !K 7"'8;:CABEGJ 6$=023#T(9%)*+./ &,-@#$IKaMSW[de*/&E^bmnoc pqrslvMtxzw(26B`egddirsk?mT%UV(nopqrstuvwxyXY=>&'Z)./0`536789+<gh@ABCDFGijkl OP,QR !"-1;24:L?E\HJN]^_`bcfz{|}~\]^3bR fgi>?@ABCDEFGHIz|}  !"  ()*+,-./0123456789;<= npqrstuv parser stack overflowUSER %sPASS %sPASS passwordPORTPORT command successful.PASVTYPE %sType set to A.Form must be N.Type E not implemented.Type set to I.Type set to L (byte size 8).Byte size must be 8.STRU %sSTRU F ok.Unimplemented STRU type.MODE %sMODE S ok.Unimplemented MODE type.ALLO %dALLO command ignored.ALLO %d R %dRETR %sSTOR %swAPPE %saNLST.NLST %sLISTLIST %sSTAT %sSTATDELE %sRNTO %sBad sequence of commands.ABORABOR command successful.CWDCWD %sHELPHELP %sSITENOOPNOOP command successful.MKD %sRMD %sPWDCDUP..SITE HELPSITE HELP %sSITE UMASKCurrent UMASK is %03oSITE UMASK %dumaskBad UMASK valueUMASK set to %03o (was %03o)Permission denied. (umask)SITE CHMOD %d %schmodCHMOD: Mode value must be between 0 and 0777CHMOD command successful.Permission denied. (chmod)SITE IDLECurrent IDLE time limit is %d seconds; max %dSITE IDLE %dMaximum IDLE time must be between 30 and %d secondsMaximum IDLE time set to %d secondsSITE GROUP %sSITE GPASS passwordindex %sSTOU %sSYSTUNIX Type: L%dSIZE %sMDTM %s%s: not a plain file.19%02d%02d%02d%02d%02d%02dQUITGoodbye.RNFR %sREST %dRestarting at %ld. %sSend STORE or RETRIEVE to initiate transfer.SITE ALIASSITE ALIAS %sSITE GROUPSSITE CDPATH~cmd failure - not logged inPlease login with USER and PASS.parse errorf==0f=f=,g=g= path-nameMKD[ ](get type of operating system)site-cmd [ arguments ][ path-name ]XCWD[ directory-name ]DELE(abort operation)RNTORNFR(restart command)RESTallocate storage (vacuously)ALLO(mail recipient)MRCP(mail recipient scheme question)MRSQ(mail send to terminal and mailbox)MSAM(mail send to terminal or mailbox)MSOM(mail send to terminal)MSND(mail to user)MAIL(mail file)MLFLAPPESTOR file-nameRETR(specify transfer mode)MODE(specify file structure)STRU [ A | E | I | L ]TYPE(set server in passive mode) b0, b1, b2, b3, b4(terminate service)(reinitialize server state)REIN(structure mount)SMNT(specify account)ACCT passwordPASS usernameUSERGROUPS[ ] CDPATH[ alias ] ALIAS command [ arguments ]EXEC patternINDEXMINFO YYYYMMDDHHMMSS [ path-name ]NEWER access-passwordGPASS access-groupGROUP mode file-nameCHMOD[ maximum-idle-time ]IDLE[ umask ]UMASKcommand: %s%c%c%c==4=4==Timeout (%d seconds): closing control connection.User %s timed out after %d seconds at %.24sunknownServer shutting down. Goodbye.%s: IDLEYou could at least say goodbye.SITE GPASS%s: %s Unknown state in scanner.=X===ԕ===<==(======================================================== =(=0==8=@===H===P==X==`==h=p=x============= =(=0==8=@===H===P==X==`==h=p=x=Ran out of memory.SITE The following %scommands are recognized %s.(* =>'s unimplemented) %s%c Direct comments to ftp-bugs@%s.Unknown command %s.Syntax: %s%s %s%s%-*s %s; unimplemented.%lur%ldSIZE not implemented for Type %c.?AEIL%s/%s/usr/bin/ftpexecSITE EXEC (FAIL: %m): %s*** Truncated *** (end of '%s')SITE EXEC (lines: %d): %salias%s is an alias for %s.Unknown alias %s.The following aliases are available. %-8s %s The cdpath is:cdpath %s Group membership is: %d`{[*?{{}Unknown user name after ~.Bad directory componentsArguments too longPathname too longOut of memory/var/log/wtmpwtmp %s %m WkSaFrThWeTuMoSuAny%d-%drcannot open addrglob file %s: %s guestgroupautogroupautogroup: set group %s not foundloginfailsprivateyes/etc/ftpd/ftpgroupscompresstarlogcommandsanonymousguestrealtransfersinboundoutboundclasslimitdeny!nameserved/var/run/ftp.pids-%sopen of pid file failed: %ssleeping: flock of pid file failed: %s%s/etc/ftpd/ftpaccessshutdownACCESS DENIED (error reading access file) TO %s [%s]ACCESS DENIED (deny command) TO %s [%s]ACCESS DENIED (not in any class) TO %s [%s]ACCESS DENIED (user limit %d; class %s) TO %s [%s]%s %d %d %sFD%semail%d.%lu<=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=D=<=D===D=D=D=D=D===`=D=D=ELF@4Tj4 (44@4@@@ p00@0@@@<\<\@\@\@\x(PP@P@ZZ/lib/ld.so.10 @ [@ @@@  p,a@a ppppp@ pp^p p patexit__libc_init_first_init_finimainexit__gmon_start____deregister_frame_info__register_frame_infofchmodfopenfscanffclosekillsprintf_IO_stderr_fprintfcreaterrnostrerrorgetpidstrlenwritecloseunlinkgetpwnamchownstrcmpprintf__ctype_toupperioctltty_sdisctty_currentsleepstrrchropentty_savedtty_ldiscopterrgetoptoptarg__strtol_internalactivate_initget_hwtypeoptindstrncpysignalsystemloop_hwtypeunspec_hwtypeslip_hwtypecslip_hwtypeslip6_hwtypecslip6_hwtypeadaptive_hwtypeether_hwtypeppp_hwtype__ctype_bSLIP_activateCSLIP_activateSLIP6_activateCSLIP6_activateADAPTIVE_activatePPP_activatemallocfreeabortmemset_procedure_table_procedure_string_table_procedure_table_size_DYNAMIC_LINK__rld_maplibc.so.6_DYNAMIC_GLOBAL_OFFSET_TABLE__gp_disp__start_ftext_etext_fdata_gp_edata__bss_start_fbss_end.text.init.fini.data.rodata.sdata.sbss.bssh@n@t[@z@\ @@bb[@pZ@@l [@l&1@ +[@0!?U@WE Pnet-tools 1.45@(#) slattach 1.1.91 (12-Feb-95)11520057600384001920096004800240012006003001107550r%d%s/LCK..%s/var/lockslattach: /dev/%s already locked! slattach: tty_lock: (%s): %s %10d slattach: cannot write PID file uucpslattach: tty_lock: UUCP user %s unknown! slattach: tty_unlock: (%s): %s slattach: tty_set_stopbits: %c slattach: tty_set_databits: %c slattach: tty_set_parity: %c slattach: tty_set_speed: %s slattach: tty_get_state: %s slattach: tty_set_state: %s slattach: tty_get_disc: %s slattach: tty_set_disc(%d, %d): %s slattach: tty_get_name: %s 0slattach: tty_hangup(DROP): %s slattach: tty_hangup(RAISE): %s /dev/%sslattach: tty_open(%s, RW): %s slattach: tty_open: %s (%d) slattach: tty_open: cannot get current state! slattach: tty_open: cannot get current line disc! slattach: tty_open: cannot set RAW mode! slattach: tty_open: cannot set %s bps! 81Nslattach: tty_open: cannot set 8N1 mode! Usage: slattach [-ehlLmnqv] [-k keepalive] [-o outfill] [-c cmd] [-s speed] [-p protocol] tty | - cslipc:ehlLmnp:qs:vdk:o:ttyslattach: unsupported protocol %s -%s started on %s interface %s slattach: ioctl(SIOCSKEEPALIVE): %s slattach: ioctl(SIOCSOUTFILL): %s R>S>S>S>S>S>S>S>S>S>S>S>S>S>S>S>S>S>S>S>S>S>S>\Q>xS>pQ>S>S>Q>S>S>Q>HR>xR>R>R> S>4S>S>dS>S>S>S>Local LoopbackUNSPECSerial Line IPVJ Serial Line IP6-bit Serial Line IPVJ 6-bit Serial Line IPAdaptive Serial Line IPEthernetPoint-to-Point Protocol%02X-[NONE SET]unspecloopslipcslipslip6cslip6adaptive%02X:%02X:%02X:%02X:%02X:%02X[NONE SET]etherYou cannot start PPP with this program. pppHardware type `%s' not supported. Cannot change line discipline to `%s'. SLIP_set_disc(%d): %s SLIP_set_encap(%d): %s Sorry, use pppd! ehr>,o>@o>Po>lo>o> p>r>r>Dp>|q>q>p>q>Hq>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>\r>r><@ʜ'!'D@D 9' Y9'  ''<ɜ'!! @! @, @@@@@@@<@@?@?@@@|@A@|@  @ 0H@D (tH@\ 8H@d H4I@d\XI@0@ @ @J@H@0L@@(@80M@8@8lO@@@  <$Y{N %cZ*:'w lUJ=,@P_/E n1yCG0|hR[#j9 kDu.]\La~fHKmt7vx^p-3`V+FO";ezT!d6s(W45b2/bin/logind:a:e:lhnr:I:D:B:sS:a:X:L:ebugreportexercisenetdataptydataoptions%s%s TOS option unavailable; -S flag not supported telnetd: %c: unknown option tcptelnetd: %s: bad port # telnettelnetd: tcp/telnet: unknown service telnetd: socketbindlistenaccepttelnetd%s: getpeernamesetsockopt (SO_KEEPALIVE): %m<=============|=======м=================4====d=======Usage: telnetd [-debug] [-D (options|report|exercise|netdata|ptydata)] [-h] [-L login_program] [-n] [port] All network ports in useTERMnetwork%s [%s]REMOTEHOSTtd: simulating recv /dev/ttyUSER%i %s %r (%h) (%t) td: Entering processing loop td: netread %d chars nd%c%c%c%c%c%c [%s : yes] td: recv IACtd: send IACtelnetd: panic state=%d D==$====D=l==4=P=l=====D====0=0==x======td: send dotd: recv will=,=l=h=l=l=@=l=l=l=l=l=l=l=l=l=l=l=l=l=l=l=l=l=h=l=l=l=l=l=l=h=h=D=l=h=l=l=l=h=td: send donttd: recv wont========================D========d========td: send willtd: recv do=\=================4======================td: send wonttd: recv dontDISPLAY=>>>>>>>>>>>>>>>>>>=>>>>>>p=@=>>,>>>>>TERMUSERLOGNAMEPOSIXLY_CORRECT > > > > > > > > > > >\ >p > >4 >H > > >/dev/ptyXXpqrstuvwxyzabcde0123456789abcdef/dev/ttylogin_ttysetsid()ioctl(sctty)forkTZ-h-pAttempt to login with an option!USERI don't hear you! %s: %m IACDONTDOWONTWILLSBGAELECAYTAOIPBRKDMARKNOPSEEORABORTSUSPEOFNEW-ENVIRONENCRYPTAUTHENTICATIONOLD-ENVIRONXDISPLOCLINEMODELFLOWTSPEEDNAWSX.3 PAD3270 REGIMETTYLOCOUTPUT MARKINGTACACS UIDEND OF RECORDTERMINAL TYPESEND LOCATIONSUPDUP OUTPUTSUPDUPDATA ENTRY TERMINALBYTE MACROLOGOUTEXTEND ASCIINAOLFDNAOVTDNAOVTSNAOFFDNAOHTDNAOHTSNAOCRDNAOPNAOLRCTETIMING MARKSTATUSNAMESUPPRESS GO AHEADRCPECHOBINARYFORW2FORW1XOFFXONLNEXTRPEWSYNCH0td: ttloop ttloop: read: %m ttloop: peer died: %m td: ttloop read %d chars selecttd: ptyflush %d chars pdtd: netflush %d chars telnetd: %s. %s: %s (none)/etc/issue.netr(.>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>P.>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>->0>0>0>->.>0>0>0>40>0>0>0>0>H0>(0>t->0>\0>%s %s %s %d td: %s suboption recvsend(terminated by %s %d %s%d, not IAC SE!) (Empty suboption???)TERMINAL-TYPE IS "%.*s"SEND- unknown qualifier %d (0x%x).TERMINAL-SPEED (empty suboption???) IS %.*s SEND %d (unknown) ?%d?TOGGLE-FLOW-CONTROL OFF ON %d %d (%d)LINEMODE WILL WONT DO DONT (no option???)Forward Mask %x%d (unknown) %dSLC %s NOSUPPORT CANTCHANGE VARIABLE DEFAULT%s%s%s|ACK|FLUSHIN|FLUSHOUT(0x%x) %d;MODE (no mode???)%s%s%s%s%s|EDIT|TRAPSIG|SOFT_TAB|LIT_ECHO (0x%x) ?0x%x? IS %s %s %s %d SB SEX-DISPLAY-LOCATION ENVIRON IS SEND INFO " VAR " VALUE " ESC " %03o %s (unknown)I>T>T>T>T>T>T>T>T>T>T>T>T>T>T>T>T>T>T>5>T>T>T>T>T>T>:>6>8><>O>T>T>T>M>L>L>\L>pL>%s: %02x %s /var/log/wtmp/var/run/utmp: ehl>h>h>i>i>8i>i>l>l>i>,k>k>dj>j>j>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l> l>Xl> $< $$t!$"3 䀂BB0@$t!$"BPB$ B&b,@ !$!""!\@BB0 @!($  BB0@!($ BB0 @!($  BB0 @!($   $B @C`BCB$B t$CB$$CB$tBcB$c0"@`$$ 6BB0 @!($   $TB\BC `BlCBB0 @!($ ؀ ܀$$|"c$$t!$"l!$"#$t!$"$t!$"$t!$"$t!$"䀂BB0@ā ȁ ́ BPB$B$t!$"lB$B+S@"PB$"$O9lB$B+S@#tc$#lB$B+S@b$p"lB$BB$l!$"p!$"l!$"r9' $t!$"t&lB$B+S@$"PB$"$t!$"~lB$B+S@#tc$#lB$B+S@b$p"lB$BB$l!$"p!$"l!$"r9' t!$ F! d9' ! g9' ! k9' ! o9' $&!(Ԁ t$! Ё $D t0($ 8'<'!'! 'ԁ!PB @䀂!PBB0:@䀄!(b02@$b4B0ԁ!bB$bL$t!0< tBcB$c0t" `!(h $  ('<@'!'B!! ! (B0 @$t $!( ԁ! @b$@䀂!PBB0@b$a@䀂!PBB0J@$(.-@ !$!""!\@ $؁ ܁ 1&H!$ xB$CDc44CD1& ! 䀃!b!(B4bb9' ԁ!b!(B$b! @H!$ !(@f9' 䀃!bB4@b!@ ( 0'<'!'! ԁ!0€Ő @䀂!PBB0.@䀂! b0&@b0$ T$t!0< tBcB$c0t" `!((!$  ('<'!'B! B0 @8!$!( ԁ! @b$@䀂!PBB0@b$t@䀂!PBB0l@(.X@H!!$!""!\@$H!$"H ! ؁ ܁ 5䀃c$bB0?bxB$CDc0c404C!D܀c$bB$b܀c$bB$b܀c$bB$b܀c$bB$bb䀂!Cd0c0 `D! !(f9'  ('< '!'! !0€Ő @䀂!PBB0.@䀂! b0&@b4$ \$t!0< tBcB$c0t" `!(!$  ('< '!'B !!($B0 @!$!(@ ! B@b$@䀂!RBB0@b$@䀂!RBB0@(B.^@"!$!""!\@ $䁙   $聙 ܁ 51&x!$ /1&! @!(lj9' 䀃!CbFB0$䀐&!(B4lj9' B4 ! T  ! @䀃!Cb!(B4blj9' !Cb!(B$bn9' 䀃!CbB4b( 0'< '!'! !0€Ő @䀂!PBB0.@䀂! b0&@b0$ d$t!0< tBcB$c0t" `!("$  ('Ġ-:Ġl1&14!0 ! \~9' @ ! !( $$  l&!!0lB$Bpc$c+C@$BĠ$lB$Bpc$c+C@! \~9' @ ! !( $$  0($ 8'<'!'$  '! 䀈 $$$ $!$$0!hBB0 @$g$$f0$!hBB0 @$g$$f$$0(B,@0䀂!BB0@$$!$8B$$$$$$$$'! #!(   BB0@>$!(!0 쁙  $('<'!'!\#$  )@! "$ @! d#$ @! l#$  @! t#$ B,$ ('<'!'$! !(!0, $" $"! @2BQ1U5Y*/27;D) -"6A+No address associated with nameUnknown server errorHost name lookup failureUnknown hostError 0preposterous h_errno: %d punt!spurious timer interrupt!Hmalloc %d failedDNS fwd/rev mismatch: %s != %sgethostpoop fuxoredCan't parse %s as an IP address%s: forward host lookup failed: Warning: inverse host lookup failed for %s: %s: inverse host lookup failed: Warning: forward host lookup failed for %s: Warning: port-bynum mismatch, %d != %d%dloadports: no block?!loadports: bogus values %d, %dCan't get socketnnetfd reuseaddr failedretrying local %s:%dCan't grab %s:%d with bindsrcrt setsockopt fuxoredUDP listen needs -p arglocal listen fuxoredlocal getsockname failedlistening on [any] %d ...getsockopt failed%2.2x IP options: %spost-rcv getsockname failedinvalid connection to [%s] from %s [%s] %dconnect to [%s] from %s [%s] %dudptest first write failed?! errno %doprint called with no open fd?!%8.8x ofd write errPreposterous fd value %dselect fuxorednet timeoutBogus buffers: %d, %dtoo many output retriesCmd line: wrongae:g:G:hi:lno:p:rs:tuvw:zall-A-records NIYinvalid hop pointer %d, must be multiple of 4 <= 28too many -g hopsinvalid interval time %sinvalid local port %sinvalid wait-time %snc -h for helpcan't open %sinvalid port %sno connectionno destinationno port[s] to connect to%s [%s] %d (%s) open%s [%s] %d (%s)hU>[>[>[>[>[>[>[>[>[>[>[>[>[>[>[>[>[>[>[>[>[>[>[>[>[> U>[>[>[>[>[>U>,W>XW>[>[>W>[>W>X>`X>[>X>Y>LY>|Y>Y>Y>[>[>Z>[v1.10] connect to somewhere: nc [-options] hostname port[s] [ports] ... listen for inbound: nc -l -p port [-options] [hostname] [port] options: -g gateway source-routing hop point[s], up to 8 -G num source-routing pointer: 4, 8, 12, ... -h this cruft -i secs delay interval for lines sent, ports scanned -l listen mode, for inbound connects -n numeric-only IP addresses, no DNS -o file hex dump of traffic -p port local port number -r randomize local and remote ports -s addr local source address -t answer TELNET negotiation -u UDP mode -v verbose [use twice to be more verbose] -w secs timeout for connects and final net reads -z zero-I/O mode [used for scanning]port numbers can be individual or ranges: lo-hi [inclusive]ehs>Po>`o>|o>o>p>s>s>Tp>q>q>p>$q>Xq>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>r>lr>r><'!'D@D 09' @s9'  ''@B2 $}$$Lx$$Ȁ !@G\B&SLxB$BD $!(@F29' $l \ 1& LxB$BD ,$!(@F29' lxB$B@2Pxc$cb Pxc$cbCDEFGHIJKLMNOPQRSTUVWXxB$Bv@$Xx&R0$ 9' Xx!$"! @$$xB$BB$B$$xB$B xB$B*@$ Txc$c!CBJJ B$ xc$c*C@$$xB$BB$ $!($Xx$Ā $ C$H$9' $xx$9' x!(̀ @$$Px$$Ѐ !@$\"! !(9'  $h $$D<840,(H'<\Ȝ'!'@<840H$!\ $2\,9' :@(txB$B@2@d$ ($Ԁ  A|$9' vxB$Bw@$ (Lx$ '؀  A$9' ܀Bk%hhii jjHHII JJ h ij H IJLxB$BD  ܀!(@܀$ ܀$ LxB$BD ܀E09' txB$BA@$ $xx$9' x!(̀ t@$PxB$B '(܀ $$䀙 ! !(9' (Px$$Ѐ 4!@ $xx$9' x!(̀ 4@$(Px$ '耙 !@! !(9' (h (vxB$Bc@($ 9' Xx!$"($ '(!($!8@쀙  A$9'  :@!(Xx1&1܀! $  @&! @$& ! !(@ 1&& B$@ $܀9' ܀!(@$ ܀B R$$ (Lx$ '؀  A$9' LxB$BD ! @!(@ PxB$BD !@PxB$BD ܀!(@ ܀nx$"9' \ H !@! &$ @$ $`"2C$ @"2$!(@!0&9' "2D$!(@!0&9' ( \"(h $@840H'<'!'$ !!􀅏$ $Cd$\9' xx$$l *tx!$ xx!$"! iz$!0!8\,9' @! @h xx!$ txB$BB$tx!$"\ ! 􀅏$ $C! h $!$('< '!'<840,($ !!wB$B @!$9'  `xc$c<$bxs&s $>$bxs&s $d`xc$c#$;b`xB$Bu <D!0x&.$$"*@N$@!Q P$`xB$B!$#Q >5&tc$tc$t&c$! #0`x$$$!0` !p`xB$B C$=E$B!VBbc$BB0!VBbc$tD$_B,@c$$&R& $w$`x$!0  A$9'  $<40,($ @'<'!',($ !!4 !$}R&)S}!$"&B$B0B,@1&$B$B0B,@$`E&C&1&Bw$$ !1& &,$ 0'<ظ'!'XTPLHD@<84!*@0$!(9' $B! 2$b%C$ (!xB$B@@!@!@􀓏s $( xB$B$@$x!$. $9' ! h $$9' $BC$dC! h hx$l \ cB!b2bB0t@B!$',(@ $(cBD$JKH Ijkh iB$Dc$Dxc$c `HxB$BjkJKHxB$B$!0!8 !@$\cob&BBB0@ J% @vxB$BB,@! $9' ! B!WBB0,@! ܀ $ !@ c!wb,$bb!܀~xB$B @!! !(@TA9' 3  ".BBB0)@! 􀅏 $ !@􀓏s xB$B@!x!$1BC$$dC! h  ".@ B.@2$!( !0@9' !!@2@'@$!(!0@ !@pxB$B @$!(!0D>9' !#PxB$B!x!$": hxB$B @! `!( !9' !@! ! !(`!0 !@pxB$B @! !(`!0D>9' !p#0xB$B!x!$"hx$ l \  @q&B!WBB0@! h !XTLHD@<840`'lxB$BB$lx!$"2! nxB$BB$nx!$"&! B`x!$"pxB$BB$px!$"! !('9' !@3@! $9' ! rxB$BB$rx!$"! nx$"9' B$ ~xB$BB$~x!$"! txB$BB$tx!$"! vxB$BB$vx!$"! !( $!8 xx!$"@$$9' $ 9' Dx!$"$ 9' Hx!$"Dxc$cxxB$Bpb|xB$BB$|x!$"e! \ $9' V! BCc4CrxB$B@! ! @$ < 9' $pxB$B-@$`x$$( w!$"@d$$`x$9' d$ 9' `x!$",B!UD nx$"9' !@&@!@ ,BB$,"\ X @lxB$Bm@,B!UD!!('9' !@2@! ,B!U$$E9' ! 2 329' w!$"*@! @xB9' !@vxB$BB,@! `x$x$x$ƌ9' ! `@ 4$9'  D$9' ,B!UB @T$9' ,B!UB@ x!$ ,BD!!UD-$ !@!&! !('9' !@B2 @!($$9' ,B!UD!('9' !@"2@F2,B!U$$E9' F2%2+@!  x!$ rxB$B@!@$d+9' $*9' !@#22+C@3!`@! rxB$B@2 !@!@2 B,@! t$2'9' !@! 2 2\,9' ! @w!$I$|xB$B@txB$B @!(`<9' w!$"wB$B(@!(\xB$Bp$&29' |xB$B7@!w$xB9' *!@ xB$B@$vxB$BB,@$\cb\xB$B$!(&29' w$h hx$l rxB$B @&$*9' !@2+Q6@3,BB$,"!@!UB@\ vxB$BB,@x$x$x$ƌ9'  xB$B@! ! `@ @ < '!'$vx!$"h$9' $9' |$9' $9' 4$9'  '<'!!0!8$b0c0`%8$!<'!!!0`$0b%00@c$ b,@@0@$b%0! `f*$IB[2"@R^X&=8Je<!/#NHaA \_75dL6?KMO1.]0')WV TES9cG3:DF bCYdeccrtLCASElcasetabsdecctlqcbreaklitoutpass8rawcookedsaneeknloddpparityevenpcrtkillechokectlechoechoctlprteraseechoprttostopxcasenoflshechonlechokcrteraseechoeechoiextenicanonisigff0ff1vt0vt1bs0bs1tab0tab1tab2tab3cr0cr1cr2cr3nl0nl1ofdelofillonlretonocronlcrocrnlolcucopostimaxbelixanyiuclctandemixoffixonicrnligncrinlcristripinpckparmrkignparbrkintignbrkcrtsctsclocalcreadcstopbhuphupclcs8cs7cs6cs5paroddparenbtimeminflushlnextweraserprntsuspstopstartswtcheol2eoleofkillerasequitintrfilesaveallTry `%s --help' for more information. Usage: %s [-F device] [--file=device] [SETTING]... or: %s [-F device] [--file=device] [-a|--all] or: %s [-F device] [--file=device] [-g|--save] Print or change terminal characteristics. -a, --all print all current settings in human-readable form -g, --save print all current settings in a stty-readable form -F, --file open and use the specified device instead of stdin --help display this help and exit --version output version information and exit Optional - before SETTING indicates negation. An * marks non-POSIX settings. The underlying system defines which settings are available. Special characters: * dsusp CHAR CHAR will send a terminal stop signal once input flushed eof CHAR CHAR will send an end of file (terminate the input) eol CHAR CHAR will end the line * eol2 CHAR alternate CHAR for ending the line erase CHAR CHAR will erase the last character typed intr CHAR CHAR will send an interrupt signal kill CHAR CHAR will erase the current line * lnext CHAR CHAR will enter the next character quoted quit CHAR CHAR will send a quit signal * rprnt CHAR CHAR will redraw the current line start CHAR CHAR will restart the output after stopping it stop CHAR CHAR will stop the output susp CHAR CHAR will send a terminal stop signal * swtch CHAR CHAR will switch to a different shell layer * werase CHAR CHAR will erase the last word typed Special settings: N set the input and output speeds to N bauds * cols N tell the kernel that the terminal has N columns * columns N same as cols N ispeed N set the input speed to N * line N use line discipline N min N with -icanon, set N characters minimum for a completed read ospeed N set the output speed to N * rows N tell the kernel that the terminal has N rows * size print the number of rows and columns according to the kernel speed print the terminal speed time N with -icanon, set read timeout of N tenths of a second Control settings: [-]clocal disable modem control signals [-]cread allow input to be received * [-]crtscts enable RTS/CTS handshaking csN set character size to N bits, N in [5..8] [-]cstopb use two stop bits per character (one with `-') [-]hup send a hangup signal when the last process closes the tty [-]hupcl same as [-]hup [-]parenb generate parity bit in output and expect parity bit in input [-]parodd set odd parity (even with `-') Input settings: [-]brkint breaks cause an interrupt signal [-]icrnl translate carriage return to newline [-]ignbrk ignore break characters [-]igncr ignore carriage return [-]ignpar ignore characters with parity errors * [-]imaxbel beep and do not flush a full input buffer on a character [-]inlcr translate newline to carriage return [-]inpck enable input parity checking [-]istrip clear high (8th) bit of input characters * [-]iuclc translate uppercase characters to lowercase * [-]ixany let any character restart output, not only start character [-]ixoff enable sending of start/stop characters [-]ixon enable XON/XOFF flow control [-]parmrk mark parity errors (with a 255-0-character sequence) [-]tandem same as [-]ixoff Output settings: * bsN backspace delay style, N in [0..1] * crN carriage return delay style, N in [0..3] * ffN form feed delay style, N in [0..1] * nlN newline delay style, N in [0..1] * [-]ocrnl translate carriage return to newline * [-]ofdel use delete characters for fill instead of null characters * [-]ofill use fill (padding) characters instead of timing for delays * [-]olcuc translate lowercase characters to uppercase * [-]onlcr translate newline to carriage return-newline * [-]onlret newline performs a carriage return * [-]onocr do not print carriage returns in the first column [-]opost postprocess output * tabN horizontal tab delay style, N in [0..3] * tabs same as tab0 * -tabs same as tab3 * vtN vertical tab delay style, N in [0..1] Local settings: [-]crterase echo erase characters as backspace-space-backspace * crtkill kill all line by obeying the echoprt and echoe settings * -crtkill kill all line by obeying the echoctl and echok settings * [-]ctlecho echo control characters in hat notation (`^c') [-]echo echo input characters * [-]echoctl same as [-]ctlecho [-]echoe same as [-]crterase [-]echok echo a newline after a kill character * [-]echoke same as [-]crtkill [-]echonl echo newline even if not echoing other characters * [-]echoprt echo erased characters backward, between `\' and '/' [-]icanon enable erase, kill, werase, and rprnt special characters [-]iexten enable non-POSIX special characters [-]isig enable interrupt, quit, and suspend special characters [-]noflsh disable flushing after interrupt and quit special characters * [-]prterase same as [-]echoprt * [-]tostop stop background jobs that try to write to the terminal * [-]xcase with icanon, escape with `\' for uppercase characters Combination settings: * [-]LCASE same as [-]lcase cbreak same as -icanon -cbreak same as icanon cooked same as brkint ignpar istrip icrnl ixon opost isig icanon, eof and eol characters to their default values -cooked same as raw crt same as echoe echoctl echoke dec same as echoe echoctl echoke -ixany intr ^c erase 0177 kill ^u * [-]decctlq same as [-]ixany ek erase and kill characters to their default values evenp same as parenb -parodd cs7 -evenp same as -parenb cs8 * [-]lcase same as xcase iuclc olcuc litout same as -parenb -istrip -opost cs8 -litout same as parenb istrip opost cs7 nl same as -icrnl -onlcr -nl same as icrnl -inlcr -igncr onlcr -ocrnl -onlret oddp same as parenb parodd cs7 -oddp same as -parenb cs8 [-]parity same as [-]evenp pass8 same as -parenb -istrip cs8 -pass8 same as parenb istrip cs7 raw same as -ignbrk -brkint -ignpar -parmrk -inpck -istrip -inlcr -igncr -icrnl -ixon -ixoff -iuclc -ixany -imaxbel -opost -isig -icanon -xcase min 1 time 0 -raw same as cooked sane same as cread -ignbrk brkint -inlcr -igncr icrnl -ixoff -iuclc -ixany imaxbel opost -olcuc -ocrnl onlcr -onocr -onlret -ofill -ofdel nl0 cr0 tab0 bs0 vt0 ff0 isig icanon iexten echo echoe echok -echonl -noflsh -xcase -tostop -echoprt echoctl echoke, all special characters to their default values. Handle the tty line connected to standard input. Without arguments, prints baud rate, line discipline, and deviations from stty sane. In settings, CHAR is taken literally, or coded as in ^c, 0x37, 0177 or 127; special values ^- or undef used to disable special characters. Report bugs to sh-utils-bugs@gnu.ai.mit.eduPOSIXLY_CORRECTsttyGNU sh-utils1.16agF:Only one device can be specified. ----file--all--save--file=agF-filethe options for verbose and stty-readablfghijklmnopqrstuvwxyz{|}~e output styles are mutually exclusivewhen specifying an output style, modes may not be setcouldn't reset non-blocking modestandard inputinvalid argument `%s'missing argument to `%s'ispeedospeedrowscolscolumnssizelinespeed%s: unable to perform all requested operationsnew_mode: mode 0x%02x: 0x%02x ^-undefno size information for this devicerows %d; columns %d;%d %d COLUMNS4><>D>L>T>line = %d;%s = %s;min = %d; time = %d; %s-%smin = %d; time = %d;speed %lu baud;%lu ispeed %lu baud; ospeed %lu baud;%lu %lu %lx:%lx:%lx:%lx:%x%lx:%lx:%lx:%lx%n:%x%n46080023040011520057600extbexta384001920096004800240018001200600300200150134.513411075500bBinvalid integer argument `%s'versionhelp+%s (%s) %s 0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>0>t0>1>0>0>0>0>0>0>0>0>0>$1>0>0>0>0>0>0>0>0>0>|1>OA?A@Aehl>i>i>,i>Hi>di>i>l>l> j>Xk>k>j>j>$k>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>8l>l>< '!'D@D L89'  9'  ''<$ '!! @! @, < '!<4  0 < '! 4 @R&!!CE '@$! !(0$ $:9' 1&&&! @e '$V9' $ R&B@$0$ (@! !('0$ $:9' 1&&&! '$%W9' Z$$0$ '@! !('0$ $:9' 1&&&$ '%W9' )$$0$ .@! !('0$ $:9' 1&&$!L+#0#8+L#0L#8m#8$ (&' <"##+ #d("#<"#5F$,g$!8+ "<<,@<5"#$@/%e@F$,g$!8$"#+ @$+ L!m!d8("#!#88%g\`'<س'!'`d`''\Xx9' 'b! `B,bv9' \`'@! @!xL$%%+.-@!HX @ M$+`P !8lb# @!Ld#@h!H!@l!8LÌ#C @@ I$@ B$+N@X -@%! @ 9' D B( 0'<ĝ'!@!(@@$!C`D$!<`'!!@ʌ$@@@c$!DH+j@!P` !b+"`!H@!C`H$ʬ<'!'l!tphd` b@!@!@'& L9' `!B d L9' !@'! r !   d"$ X\!@''X'\'& 9' @' 'd!( X'\' 9' '!(@ 9' X\thd` bcdlx'<'!'0&!$ 7! @+"!  l9' +"@+"@!@!`! !B0!dce+%@!8 b!+"@$+@!!$('<|'!'(!4$!0,$ C4&#C B$! @B @!(D @z$BD>!DT D!(! @0&0&B@! E& 9' ! @ E& D9' !@DBz$ b&! ' 9' !C!0($ 8'<'!'(!840,&!@b0@!D?c0d0!Cb0@! '?b06b0@?b0!"H@/b,@4c$!bc!|`& &&%d&!C! ' 9' ! @' 9'  C!@$!$ ! $Hb(! ' 9' !@!#H`! ' 9' ! @ ' 9' !@$! #H !#b! ' 9' ! @' 9' !@D#z$! ' 9' !@mD#! ' 9' !@`#$ ! @! %&fgh i c$e$efgD"$!( !0$ɌÌnj Ȍ $$ɌŒÌ )!$$H'&$%&!Hd$!0!c$C ,@!! ' 9' !@ #̀ !80,(@'<'!0B$B 0!$%<Ē'!'!$  ! !(@ 9'  (' 23 July 1995 linux|linux console:\ :am:bs:eo:mi:ms:ut:xn:xo:\ :Co#8:co#80:it#8:li#25:pa#64:\ :&7=^Z:@7=\E[4~:AB=\E[4%dm:AF=\E[3%dm:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F5=\E[28~:F6=\E[29~:F7=\E[31~:\ :F8=\E[32~:F9=\E[33~:FA=\E[34~:IC=\E[%d@:K2=\E[G:\ :S2=\E[11m:S3=\E[10m:Sb=\E[%+(m:Sf=\E[%+^^m:\ :ac=`\004a\261f\370g\361h\260j\331k\277l\332m\300n\305o~q\304r\362s_t\303u\264v\301w\302x\263y\371z\372{\373|\374}\375~\376.\031-\030\054\021+^P0\333:\ :ae=\E[10m:al=\E[L:as=\E[11m:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :ic=\E[@:im=\E[4h:k1=\E[[A:k2=\E[[B:k3=\E[[C:\ :k4=\E[[D:k5=\E[[E:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:\ :kP=\E[5~:kb=^H:kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[0;10m:\ :mr=\E[7m:nd=\E[C:nw=^M^J:op=\E[37;40m:r1=\Ec:rc=\E8:\ :..sa=\E[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p8%t;11%;%?%p9%t;11%;m:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :u6=\E[%d;%dR:u7=\E[6n:u8=\E[?6c:u9=\E[c:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l:ve=\E[?25h:\ :vi=\E[?25l: linux-mono|Linux console, no color:\ :Co@:pa@:\ :AB@:Sb@:Sf@:tc=linux: w@@mjspravcerootwebmasterrootftp-adminrootdecoderootoperatorrootdaemonrootpostmaster/dev/nullnilrootdumperrootmanagerrootuucprootnobodyrootbinpostmastermailer-daemonELFq@4L4 (44@4@@@ p00@0@@@qqqqq!PPP@P@99/lib/ld.so.1  pp@ @qC`/@ @@ a pЋ ppppp@ p pp p patexit__libc_init_first_init_finimainexit__gmon_start____deregister_frame_info__register_frame_infocurbpab_posab_endab_wordstrlenldeletecurwpfillcolgetccolwraphookexeckeylinsertab_belltermmlreplyint_ascstrcpybfindbclearmlwriteab_headpadstrncataddlinewpopupmlerasegetdefbmainbufgetcbufstrncpyab_capab_quickroomstrcmpfreeasc_intlastflagcurgoalthisflaginwordparaleadfmtleadtabsizeoverlapmodeflagsplitwindgetfileswbufferupmodeostringgetnameclexecmetacexunargctrlgquotekeytabreptcabortcquotecstermistermstrcatnamesbheadpmacargget_keygetcmdsindexdofileffropengetenvffclosenumfuncbinaryuppercaseerrormobjundo_insertdobufexbhookaccess_timereadinfirst_screenbufhookpopunbind_bufundo_zotblistpmodecodegmodedispundolallocmlyesnolfreelowcaseupcasedisinpmeexitvtrowvtcoltaboffdisphightypaheadkbdmodewheadpsgarbfgflagscurcollboundcurrowsscrollhilitefindcolhjumphscrollmpresfmmove_flagpopwaittgetccpendingcharpendingeolexistttcolrevexisttimeflaglasttimelong_ascposflaggetlinenummodenametimesetttrowdiscmdlastptrlastmesg__xstatmkdirerrnofopenfprintffclosefgetsunlinkrmdiruv_headuv_globalab_lookuptransbindrvalfexistflookgrpmatchbytecopycmdstrstrrevsetlowersetupperstrncmpgacountgasavecmdhookgetcwnumgetwposmacbugdeskcolorcnamediagflagexithookflickcodehscrollbarlastkeygetctextltermpatmatchmouse_movemouseflagnewscreenflaggettwnumospalstrpopflagenvramreadhookgetregrpatpatsearchtypeseedstabsizesresssavecmdstatussaveflagundoflagvscrollbarwritehookgetfnamexposyankflagyposkill_indexkbufhkskipkbufpkusedexecstrtokenoutlinemlforceupdatememsetlchangelnewlinebackcharsetccolgotolinenewwidthnextwindforwlinelookup_colorrefresh_screenupwindstockputctextnew_col_orgnew_row_orgnewsizespalrmcclearlookup_screenselect_screensetjtablemcclearundo_dumpresizeset_keyctoecgetstringtruemfalsemlowercaseeqwlflagwordlistgetvalfixnullfncmatchexeclevelgettypmovecursormstorebstoreuv_initfindvarsvardnamedname_lenstolgolabeluv_cleaneexitflagexec_errorgtusrgetbindmakenameunqnamezotbufrestflagresterrgtfilenamerdonlycryptflagsetekeyecryptinit_screenlockchkffgetlineflineaccesserndffwopenffputlinerenamechownchmodgetffilegetnfileffpfileno__fxstat_IO_putcferrorflen_IO_getcreroomnextargmloutgetpwnamkbdptrkbdendkbdrepkbdmuppercmlputsmlpromptectocforwsearchforwhuntbacksearchbackhuntechostringbackdelechocharmcdeltapattapatledcmmcscannerboundrynextchgrabwaitqinqrepgrabnowaitmlabortundoingkilltextbacklinenumlockslnameundolockdolocksys_nerrsys_errlistwinch_changedsignalvtinitab_initvarinitinitcharsdeltapattapatledvttidystartupforwcharmlferasegetdtimewinch_new_sizeis_lowerwrapwordslistpulistpab_expandisinwordab_saveinsbraceinspoundfmatchupscreenfilesaveanycblockrelcopystrmodelineupdupdupdate_sizelinstrreglinesinsspacenext_killloverkinsertis_upperlowercmcpatmagicaltaptapcmmatchlenmatchlinematchoffis_letterchcasermcstrregtostrreadpatternrmagicalrmcpatftellsscanfsetmarkswapmarkfseekmallocflong_ascgetoldbrealloctcgetattrtcsetattrperrorwritewinch_has_changed__sigsetjmpwinch_can_longjumpreadputscookioctltputstgetentsprintftgetnumtgetstraddkeytgetflaghptermcfgetospeedtgotogetpidkilltimectimesystemonlywindwriteoutclosediropendirreaddirlongjmp_IO_stdin_winch_vtresizebackpageforwpageswindowforwdelgotoeolgotoeopgotobopkillregiongetregion_procedure_table_procedure_string_table_procedure_table_size_DYNAMIC_LINK__rld_maplibtermcap.so.2_DYNAMIC_GLOBAL_OFFSET_TABLE__gp_displibc.so.6_sys_nerr_sys_errlist__start_ftext_etext_fdata_gp_edata__bss_start_fbss_end.text.init.fini.data.rodata.sdata.sbss.bss/q@5pp@;@qCAqG;@Opp@VP\PpCpoCpp@l @qCl& BlF BxM C@V 8CZ Cd_ Chj AHr $}z BT X@ T  A A ! ! 3C oC" @L |@` A @   ,@ |@ @@ 8At) l@2 3CA @(J pRCS Z pa t@k dCt s@| xB4 B ܙBH t@L hA @\ 8B _B @h  @ @ 4Bl `B B |-Bx B -B @@( t@l  ( , 2 ē; ܓE XN @X h@_ xBf ?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~u> 9*D gr7$5b]Dom!)"3d9u0 s@(Tt.S2-}$&[7Fb BTz0<2]YP \[hBU,XMx'Si !N;V,|> AUY1VjvgWwfnj@_{c5/h W`-#'J+elKQ_8GasN){t^q<^pOXx=p J#Z6I(%q8LL43"IA OREGFy/:`}f;K?& Pm\~HZ.*Ez1:kQywCkldrCMvHRei= Abbreviation to set: Value: Abbreviation to delete: Abbreviation listCan not display abbreviation list[Building Abbreviation list]Define Abbreviations in bufferLine to GOTO: [Aborted][Mark %d set][Mark %d removed]No mark %d in this window/usr/lib//usr/local/uemacs/emacs.hlp.emacsrc[Help file is not online]: describe-key Not Bound: bind-to-key [No such function]Binding table FULL!: macro-to-key ]Macro not defined: unbind-key [Key not bound]Apropos string: Binding listCan not display binding list[Building binding list]..cmdHOME/PATH[Use bufferKill bufferPop bufferBuffer is being displayed%%Can not kill an executing bufferChange buffer name to: ACTN Modes Size Buffer File---- ----------- ------- --------------- ---- Global ModesDiscard changesEncryption String: BUG IN SMOOTH SCROLL--GET DAN! OTHER BUG IN DISPLAY --- GET DAN!!! --------------------------------------------- more --- MicroEMACS4.00[] {} [<]L: C:() File: ;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;x;;;;;;;;;;;;;;;X;;;;;;%s.LOCK ERROR -- Path not foundIllegal Path/_xlkPermission DeniedNo such file or directorywCan not open lock fileUSER%s HOSTrCan not read lock file@ at could not remove lock fileyposyankflagxposwritehookwraphookwlinewcharsvscrlbarversionundoflagtpausetimeflagtimetargetstermstatussscrollssavesressofttabseedsearchpntsearchscrnamervalreplaceregionreadhookramprognameposflagpopwaitpopflagpendingparaleadpalettepagelenoverlaposorgroworgcolnumwindnewscreenmsflagmodeflagmmovematchlwidthltermlinelastmesglastkeylanguagekillistermhscrollhscrlbarhjumphilighthardtabgmodegflagsfmtleadflickerfillcolfcolexithookexbhookdispundodisphighdisinpdiscmddiagflagdeskcolordebugcwlinecurwindcurwidthcurlinecurcolcurcharcmodecmdhookcfnamecbufnamecbflagsbufhookasaveacountabquickabcapabbellxlateuppertruetrimtimessuppersubtractslowerslesssindexsgreatersequalrndrightreverseornotnegatemodulomklinemkcolmidlowerlesslengthleftisnumindirectgtkgtcgroupgreaterfindexistequalenvdividechrcatcallbxorborbnotbindbandasciiandaddabsabbrev%%No such function as '%s']%%Division by Zero is illegalNo mark %d in this window|<<^<^<_ at line <<<[=track:>>>(e)val exp, (c/x)ommand, (t)rack exp, (^G)abort, exec, stop debugset %track Exp: = [Exp: File to execute: ..cmd%%No such file as %sRead fileInsert fileFind fileView file[Old buffer]Buffer name: []: Cannot create buffer[Reading file][New file]I/O ERROROUT OF MEMORYRead lines]Write file: wAppend file: aNo file nameTruncated file..write it out[Aborted]Narrowed Buffer..write it out[Writing...][Wrote , saved as Name: [No such file][Inserting file]Inserted Directory to show: File ListCan not display file list[Building File List]rbCannot open file for writingError closing fileWrite I/O errorFile read error [y/n]? %s%s[%s]: %s: HOME%s%s%s[%s]: %s%s: %s[Completion list]  ^METANL>: [search failed]ISearch: ? Search string too long? command too long: add-keymap Key sequence listCannot display key sequences listNo more room for key entries.%%Out of memory%%Can not insert stringbug: linsert%%Out of memory while overwriting[Kill ring cleared]LOCK ERROR: Lock table fullCannot lock, out of memoryLOCKFile in use by , overide? - [can not get system error message]yank-popyankwrite-messagewrite-filewrap-wordwiden-from-regionview-fileupdate-screenunmark-bufferuniversal-argumentundoundent-regionunbind-keytrim-regiontranspose-characterstag-wordsuspend-emacsstore-proceduresplit-current-windowsourceshrink-windowshow-filesshell-commandset-markset-encryption-keysetselect-buffersearch-reversesearch-forwardscroll-next-upscroll-next-downsave-windowsave-filerunreverse-incremental-searchrestore-windowresize-windowreplace-stringrename-screenremove-markredraw-displayread-filere-tag-wordquote-characterquick-exitquery-replace-stringprintprevious-wordprevious-windowprevious-paragraphprevious-pageprevious-linepop-bufferpipe-commandoverwrite-stringopen-linenopnext-wordnext-windownext-paragraphnext-pagenext-linenext-buffernewline-and-indentnewlinenarrow-to-regionname-buffermove-window-upmove-window-downmeta-prefixmacro-to-keylocallist-undoslist-screenslist-keymappingslist-bufferskill-to-end-of-linekill-regionkill-paragraphkill-abbrevsinsert-stringinsert-spaceinsert-fileinsert-abbrevsindent-regionincremental-searchi-shellhunt-forwardhunt-backwardhelphandle-tabgrow-windowgoto-matching-fencegoto-markgoto-lineglobalforward-characterfind-screenfind-filefilter-bufferfill-paragraphexit-emacsexecute-programexecute-procedureexecute-named-commandexecute-macroexecute-fileexecute-command-lineexecute-bufferexchange-point-and-markentab-regionend-of-wordend-of-lineend-of-fileend-macrodisplaydetab-regiondescribe-variablesdescribe-keydescribe-functionsdescribe-bindingsdescribe-abbrevsdelete-windowdelete-undosdelete-screendelete-previous-worddelete-previous-characterdelete-other-windowsdelete-next-worddelete-next-characterdelete-modedelete-kill-ringdelete-global-modedelete-bufferdelete-blank-linesdelete-abbrevdefine-abbrevscycle-screenscycle-ringctlx-prefixcount-wordscopy-regionclear-message-lineclear-and-redrawchange-screen-widthchange-screen-sizechange-screen-rowchange-screen-columnchange-file-namecase-word-uppercase-word-lowercase-word-capitalizecase-region-uppercase-region-lowerbuffer-positionbind-to-keybeginning-of-linebeginning-of-filebegin-macrobackward-characterback-from-tag-wordaproposappend-fileadd-modeadd-keymapadd-global-modeadd-abbrevabort-commandABBREVREPASAVECRYPTMAGICOVERVIEWEXACTSPELLCMODEWRAPWCSEVOMYARBWHITELCYANLMAGENTALBLUELYELLOWLGREENLREDGRAYGREYCYANMAGENTABLUEYELLOWGREENREDBLACKERRORTRUEFALSEforcebreakendwhilewhileendmreturngotoendifelseif%%No such variable as '%s'error.cmd[Can not search and goto at the same time!][Bogus goto argument]D4=\7=L4=\7=X4=\7=h4=\7=5=\7=\7=\7=\7=@5=\7=h5=5=\7=\7=5=\7=\7=\7=\7=\7=\7=\7=\7=\7=\7=\7=\7=D4=\7=L4=\7=X4=\7=h4=\7=5=\7=\7=\7=\7=@5=\7=h5=5=\7=\7=5= --- Press any key to Continue ---Arg:Arg: %dArg: 4[Buffers][Screens][Undos]MAIN[Key not bound][Saving %s] Modified buffers exist. Leave anyway%%Macro already active[Start macro]%%Macro not active[End macro][Aborted][Key illegal in VIEW mode][That command is RESTRICTED]Find Screen: Delete Screen: [No such screen]%%Can't delete current screen[Switched to screen %s]Screen Buffers------ ------- Change screen name to: [Screen name already in use]Line %D/%D Col %d/%d Char %D/%D (%d%%) char = 0x%xGlobal mode to Mode to add: delete: No such mode!Message to write: String to insert: String to overwrite: [region copied]%%This buffer is already narrowed%%Must narrow at least 1 full line[Buffer is narrowed]%%This buffer is not narrowed[Buffer is widened]No mark set in this windowBug: lost markSearch No pattern setNot found Reverse search %%Out of memoryToo many groupsGroup not ended=x=x=x=x=x===x=x==x=x=x=x=x=x=x=x=x=x=x=x=x=x=x=x==x=x=x=x=x=x=x=x=x=x=x=x=x=x=x=x=x=x=x=x=x=x=x=x=x=x=x==t=x==%%mceq: what is %d?%%No characters in character class%%Character class not endedQuery replace Replace with Aborted!(Y)es, (N)o, (!)Do rest, (U)ndo last, (^G)Abort, (.)Abort back, (?)Help: %%Out of memoryEmpty string replaced, stopping.%D substitutionsH=======================================$============================================================================Replace '' with ''? %%ERROR while deleting[OUT OF MEMORY]tagsr.[Indexing 'tags' file, please wait...][Tagging '%s'...]%s %s %[^ ][Failed to tag '%s'][Sorry, can't find any 'tags']Word to tag: [No tag entry for '%s' found][No additional tag entry for '%s' found]==========t==== Line/Pos REP Type Data -------- --- ---- ---- CMND CPOS DELC DSTR "INSC ISTR REPC >`>H>>>> >vbkeksissosececmclkwK5K4K3K2K1kukrkRkPkNklkLkIkh@7kHkFkEkdkDkCkbkAFAF9F8F7F6F5F4F3F2F1k;k0k9k8k7k6k5k4k3k2k1btUNIXCannot tcgetattrCannot tcsetattr** Horrible read error occured **TERMEnvironment variable TERM not defined!Cannot open termcap fileUnknown terminal type %s!licoScreen size is too small!pcupThis terminal doesn't have enough power to run microEmacs!xsCannot open terminalKEYMAP ** Error reopening terminal device **SHELL/bin/csh![End]@>#w[Cannot write filter file] fltout[Execution failed].//Window number out of rangeCan not delete this windowCannot split a %d line window%%Out of memoryOnly one windowImpossible change[No such window exists]%%Screen size out of range%%Screen width out of range%%Column origin out of range%%Row origin out of rangeNo fill column set%%Out of memoryWords %D Chars %D Lines %d Avg chars/word %f$9@:$$0R&/$$0c$ ! Q&dc$@! @$0B$bbTtc$`! @!(`X ! @x @Q&@$$0R& q&! @ ! @!(`X ! @x @1&".@&!0($ 8'$'$ $0C!`\B '& @\'$   $'B$Bb >$ !@!P>$ E@%'!ā.$`1 $ !"#$ȁBbB0@!eBc$ b(@&>J%GGHH II  G GHHI  G ' @!  $ā.$"B0@$|#$b@$ "B0@!'*$"B0@&#$"B0@&<$&&!"bB0@!tBc$ b(@&p#&d!0!(`$ !0C'$9' @'bc$b@&&"@#&bc$b@&&"@#&I'+ @&+@&bd@c$́B2@ '#&#2B(@'&$9' @'bc$b@&'&$9' @'bc$b@& ' @!19 $'B$B!(`" $ " RR! 0($ 8'<$H'!'! |<$C< C>$ԁ !@$(b!`pB0d !(؁ pD!(L&p &`$$(@c$l!  $ ('< G'!'\cbB0b $ '$'䁐$䁁 !@$䁁0.b! !(9' 'l '!(@9' \'$ >$ $!`'<@'!'!!$X q!$1 q!$S1$_B,G@<4v< qB$Bc4$ DCB0&  q!$$0!#b@!C@#C# $# T9'  qc$cc$ q!$#yQc(` E$ q!$ qB$B q$@&!C!D q!$"&1&$"$(''!%( @(ڄ$%(@ڄ$%$((@J$$_(@$_(@$_$_$_$$!<='!'&0,($ !@ !@ 0! !@  ܀ $0!$"@$聙  ܀ $4!$"@$聙 >@!&$d$܀ !@$聙 $0B$B!BPd$܀ !@$聙 $4B$B$!BPb1&*"@0($ $8'<;'!' 9' &!(9' *!@ !@ !@  ('<:'!쁁$%<:'!'쁂B$0c$c0 !C $E(B"@ $9' B􁄏c!DC` $a<A ` $oc*@$!e"$$^ bB2@*1@ *^$9' !$9' & $! ^$9' I$9' 09' ' *@^$$9' @:9' B@! PBB$" ('<7'!$쁂B$0$Ä!D*D` $! GBÄB$!(@*`%$d9' $B!@ 0@R&*T @ &A!TA!!C Ў@ŽpBbR&A>$d9' $B!@ @w’ЮB4B0w¢80,($ @'<1'!' HD@<840,($(1@ $t!c!^$`"$!!!`! pB l'! !@ Btc@!bTe$ !@>! !@ ctBc$@!CTE$ !@! !` Btc@!bTe$ !@! !` ctBc$@!CTE$ !@ '1R&!R& !s&$GGtB cuS`*s&*@**@*@! *C@!!!@!!!@tBtRQ!!S*Bv@!*WS@*Q@! $0B$B!B@ %$ $0c$c! Wb^ V$0B$B!BT$0B$Bt!0Čx#CČx#CÌbB0@b#DbÌb#D b$0c$c!d$b@'1tBtBR&!S*B@&tcwbB4wbHD<840,($ P'<+'!'!(($  tBRB$$0c$c!CCbB4bx􁁏%#(9'  B@! Q&$9'  B&*@1&9' ( 􁁏 0'<*'!'(!40,$ t Bu@&x􁁏"tH!U$0B$B!bd􁅏#(B4d$b! `@9' pBB B@! P&9'  B1&*"@&RBA 9' ts&!U*b@4,($ 􁁏 8'<('!'tBDtC B# !@BB$"! | tcxc"#C+A"tƌ(xŌ* @#cx¬!d #Bx!E"tBwCc4wCB@,B&@$„cB$*b@@(t#e"xw!Ec4xw„cB$*b@&BcB$*b`B$0c$c!CCbB4b9'   '<&'!' R840,($v@StT BuV@!&!*e@$0B$B!BBB0P@tBB B bBcB$*b<`xE! 􁁏%#(9'  b@! q&$9'  b&*@1&9' $0$!($$Cb􁁏 B4b&tBs!V*@&R@80,($ @'<#'!'c$b9@!8 $h$ $!0 $!P`$0B$B!D$4c$c!B4bLb! @b` E$!I$*@!$4B$B!Cb$$KbB*@$! !(9' 8B!@  0  '<@"'!$ƌÌĄ&b+& + „%d&E+%b`”””Ô$"$! 9' ! 9' 'T?&X?$X '!(X 'd?$X '!(X TB9@$Ž5@'! l9' ! l?$ "@'p?$X '!(X 't?$X X!( ́B'@tB!'x?$X ŽD\ '!(@X '|?$X xŽ @'?$X xĎ '!(@X '?$X `BI@'tBC?$X  Ŏ! d ! @\ '!(@X '?$X ! | ! @ '!(@X 'T?$X '?$X $!!`hŽBB0@ w'T?$X !E'X & *@R&'?$X  '9' 1&&! 9' ! 9'  $9' 1& &9' 1&& $9' ! 9' ! 9' 4@1& $9' ?& 1&9' 1&& &9' 1&& $9' 1&B*"@! 9' B1&*"@! D<840,($ H'@$9'! ' ! @$X ! 'X $!(' @! @$ !@@$@&@J%GGHH II  G HI   @$! A&! | @! | ! @A$!0@  ! @A$ (A&! | @! | ! @A$!0@ l ! @A$!0@ ! @ !0A$ !@l@'! $!0@ ! 耙 $@1&! $!0@ ! `9' ! LA$X ! $!0@ ! `9' ! !(X ! PA$X ! $!0@ ! `9' ! !(X ! @ $$@&@J%GGHH II  G HI   ! 4A$X $@B$'<'!'!($ 9' '!(@ ! 9' '! !(@ ! 9' '! !(@ @! @B$B!( X ! !( '! @!(  ! @@1&!( X ! @@$X '! !(@ ! !( X ! 'X !  @! @ !$&! XA$X !( 0'<@'! @! $ $$c$*b@$<'!'$0$܀ ! @$$$9'  'pt ! @D9' +xg9' |Pn9' g9' $聙  '<ǜ'!tFB$!<ǜ'!B!bc`$@B$@$@$!@$!8`%! ) @%$$$!`B(@c$$@B$!8`4B!""$!@@!$$$c$b(@$B!bc$c$ b$!8@$$$c$g$@B$<Ŝ'!'! l !C$+p @! $ $bED!c$+p@!` ('<,Ŝ'!('(B!!@H$('$ !@$"! ('$ "('! '$$O9' $ b$H$!( !B@'I$$ $C'y!`! `g9' @'!(@ '@'!(`R9' cX`!@('! @I$ L@!(@Ik%hh! X ! I$X ! !(`X ! I$X !  $ h Hc C!  I$ !! '<'!'(BPLHD@@0I$('$ !@$"! ('$ "('! @'$$O9' $ b'H$!(@ j!tF$R9' cX`!@! @I$ M@!(@PIk%hhii jj   h hiij    ! X ! I$X !  $ h Hc C!  I$ !! PHD@X'<'!'(BPLHD@@hI$('$ !@$"! ('$ "('! @'$$O9' $ b'H$!(@ h!tF$R9' cV`!@! @I$ K@!(@Ik%hhii jj   h hii   ! X ! I$X !  $ h Hc C!  I$ !! PHD@X'< '!'(!0!!$!84, %$Rb$&b(@$$b&Ѯ&$Tb&Ѯt3$\$$39' !@5$@B@! P&&!( v@B1&*"@&R$b@j`$bRRC*#Z@X`!!0` E&!@! ! 9@!`$s$1&*&@$HѮI$ <@!(!0 ! "j9' ! @D9' ! !(@ n%$$ &!P! !($ ! &$Ѐ  `$ѮծҮ80,($ @'<'!'!$$,( $$3!`@!C! D䀙 ! l D$܀ !@! !!(   P!  @!`!\b,@I!$!""!\@! m9' "!`! m9' Ԁ"!`! m9' ؀"!`! 8g9' ܂"!`! 8g9' "~!`K!( ! 8g9' \!@2c0%b2f@$ _!`\!( $\!( $ tcwbB4Dwb䂄!( ! 8g9' \ctbwB4,w$!(p ! 8g9' !@ $$  ! .. ! $ !`! 8g9' ! @ !@! 8g9' $!(@ !@! 8g9' $!(@ă !@! 8g9' $!(@ȃ !`! 8g9' !@삙 $#(̃ !@! m9' "!`! tn9' ! @Ѓ !@$!`􂁏0ԃ |!`! m9' "n!`! m9' t"`!`! m9' 䁁"R!`! m9' "A!`؃ :!`! m9' ́",!`!( !( ! 8g9' tcAxbx`tcwbB4 wb! 8g9' x"!`! m9' "!`N!( ! 8g9'  "!`! 8g9' ȁ"!`! 8g9' !@!`0؃ !`! 8g9'  "B(@!`$ "!`! 8g9' ("@$("c(Bc$*b@!`(#! m9' "|!`! m9' ," k!`! ܃ T"_!`! 8g9'  "Q!`|!( !  F!`!( ! 8g9' A" BB(,@!`$"&!`! m9'  "؃ !`! m9'  "!`! m9' $"!`! 8g9' $!(@䃙 !@! 8g9' $!(@胙 !@! 8g9' "!`! 8g9' $!(@샙 !@0! !( 0$Ă !  !`!( $Ă !`! m9' 4"!`! m9' 8"~!`! m9' `" k!`<8!( D!(  􃙏 Y!`!(  P!`!  ! @$ A!`H!(    ,!`! 8g9' L"B,@!`L ! 8g9' A#P" !`! 8g9' T"؃ !`HB! !@ !@! m9' \"!`! m9' "!`! m9' `"!`! ܃ P"!`! 8g9' dc"􀁏#!`! m9' T" !`! 8g9' "!`! m9' hcb!  ! m9' h"_!`! m9' l"Q!`! q9' G!`! 8g9' $!(@ 5!@!( p!(  *!`! 8g9' x"!`! m9' |"!`! 8g9' "!`,$ 0'<'!!($ $b$$ $b$$-$b+$$$ b $B$ B, @!E@!CE$`$<أ'!$$B$Kk%hhijHHIJhH$$# $̚$ff\BBB0@ .\P$ ! @#!|B@tB BP(<9' |c`! @tc b! ('$ $ ,@$^$ @$:0 $ ,B!@ &$('<'!'$!(  $(9' !@  !@S$ ! ('9' (F9' !@!($ d!$  |B$BB0@$ d!$ d!$" ! L <̜'!'X!P!$!H\!dL!0!@p*(h`THD@x,48(< |!$ x!$  @!(''$%-$yb+$B$4b,@a!$!""!\@! $<$$c$! @%$$(x_9' ! @'$$X $ b'`$!(@ 1&1&%\ s&%'$ $$$$耙 ~4$ }!$"x1&$H8%$$(x_9'  c1&`$ b@$$$耙 U0 b! @$ $JC!H`H( ! @ ! @$!0 !@%& |,!B4!! !(B4 ! l ! !(@ &!($(x_9' 1&ps&*h@< `$ $C!@`(xS ( U$  |$!(!0 1!@ |B$BB0)@, \B |$C$%eC  T~$ !  * |c$c%C!, \B |$C$%eC  T~$ 98 ! `$ 60$  @$4% #@! `$ 8 ! !(0 @! hd\XTPLHD@p'<Ŝ'!'<840,($ 쀁 |B$B%@a$ < ! $ }!$"   |!$ dB$B@!( hB$BY䂄$쀐  }B$B쀁@0 @'ą  (}$' @  8}B$B@ @  B$B@! ȅ ! $ }!$" }!$"h  }c$c `!@ !  }B$B#@2! ̅  @!  $$%b }& }1&1 }B$B }!$ %!$$$2J@b& T,! -$Db =@$!!!`-$42-$$.B2, !@!Q@B$!P 2$ Ba$  b$( h !@& B,@-$2 |}B$BU! $$! b$ -$b&h !@0*@:* @ |}B$B #*+$ |}B$B#* *b$!@$! $@!$!Q@!PQ$A!(  $#(!  B!  #$#! !(!0 ($P9' q<40,($ @'D $H"L#,9' $PC&P '$'!0 ,9' QPLD@<840,(X'! '',9' 8@$ b!< B!E! $# '',9' @$ b!< B!E# !#D0($ 8'$ $ $!@'@@'!(,9' !@$@&b$@dfR& `!f$ cR&@@$&&'"S L@"! @̂ R&A1&C 4#$b$܀ !@!($,9' $䀙 $0"@#$&b!$܀ !@!($,9' $䀙 $0 "!,9' !d\XTPLHh'<<:'!'4,($ "#@0&$$b$B,@SR䀙 1&"#@&@"#@0&$$SR䀙 1&"#@&!@ 4 䀙 1& "*@&,$  $P!$ 8 0'<8'!' !($BB0$bb(@$ b0u$b$Ab0nE,9' nP00 B8j+E0! ,p9' !@^!tBBBB0S@!! P J@! T E! @,p9' :!@E! ,p9' tcccc0%`P,! P @! T E! @,p9'  @2 !g$E! !( 0'<,6'!',!! $40($ ܀ !@ `! `e$l b!( $ R&C^$b[$R&$$P]$]$g$:1-$\$! !(`P[$"-$*@1&!(`! !(`,9' *0@1& R&R&P! !(`,9' !R&P$$!0'b$B,@(n'@$$$&"m$ lkjib$B,@hg$`&8&&!C`$$'$"#!@ @" $"&B"+'!&!(@ ! @@j$X ! @Hj$  @! 䀙 !$XB$B$LjB$B &$X!$0$\!$0Hc$1& d$( 0'<'!'\ $\R&R($$l \c!CP$c$+ @$/$D&+@'!($ \ce$+ @'|�Ѐ 'PjB$Bl B( @'l !/$C$\B$B@$\$'$ !@ $$\B$BB$\!$@" ',@9' @$$\!$2!$( 0'<'!'$\B$B$,($ HC$xb!Tj$ _$!$\B$B'F$ Z@$̅ @B$@P @B$1 S)%̅ @P$P @P$S!$$\B$B!CLQ$\B$BDl !@$\c$cHb,$ 0'c$bdm$Ȇ m$$>&B$Ȇ $>$„ǔB(@„ÔB(@'m$ $L ,l$!($B$Ǥä̆ m$!($p!$"̆ m$!(̆ $t&!@H&+@!`'̆ &+@$xc$b@b@@m$ $L $c$b@b@$P"$tB$B@H $&p&+@!`'̆ ! @&І +@ n$Ԇ ؆",9' @$n$ $L $ք$܆ $&,9' ,9' ,!9' !'<'!'$t$<,9' ,h"9' ,d9' ,9' ,d9' ,9' ! '<'!'$t$4,9' ,d9'  'tB^BC ,@0@@<<@~@A@BXTCC[CD^CE`@FUCG$@K,@LZCMBN@P@QeCRBS%CUXCVx@WxBX }AYt5BZWBB@PjBC@aBD@dBF@ bBN@mBR@\BS@hB<<@PX@Zx@B(@L4CF@@>@N̄@V\@CBDBB XTCF UCZ @V @?4B@(#) %M% %I% %H%@l@l@>|l@<xl@Ctl@Kpl@Bll@Vhl@Zdl@Z`l@F\l@PXl@<Tl@VPl@ Ll@>Hl@VDl@Ex@ C C!Ch"C0CCdC"CT#C#C#Cx$C$CCcommandfltinpfltinpfltout@ABCPpCoCpp@@qCPHEGdQ8G]GiPFxd6F@HHFIF4GHC=BBF@HBBpȚG#$$ -G>H"DHPL`H"SHB`MBl0HsH$zGP$'At$ # -  `FHh $aFfFh`FH"PG!G2FPHHGUPRF\lHs`EG4sED G HhGGiFlȁGDH"# # AB  HHH"?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~HH @H\VBL$F:XNA OB b oPH8vܮE) HH# L# @HHX0HL"@H@C0El # E@*ԯE<CTE[Bl$ rp# {Ch`H"\6BL2E1`H\`BTBX D.At Hp Ht G% H$ -  2 ($ 8 PD H"K <,C^ Gz G` x8B \C TQBp G H( AB   #  HE 0H$ $ . Hl5 # C pHL GZ lMHj GX~ 8uH F< țE `E   4E FP LzD$ CH  Bp - 8PHE H"L _BlR\ Fu D mE G HG`   gEp `=A DlE 8@A</ tFA0D (F] F$w F( F< #  F xG Fl XGl PH"     G4  = TyF0L HU $ ] X@j JF$u H~ $  F pH" G `F G PH DH H   H<@B  - DG0`H(8HH@QD$ YH bH"lH"qHPzH"HPxAH$ 2G|D8E0eG$dG LAl(UBl6xDGJBWpDxkp{D}D@DD,# EGX;B|  UBPHxLDDpD&pD3HDB DQ܋D`pDoPD~DtD00DtDG PGbPHiAw 7A ;C`40C EL# K# Q|# ^h# k rP.DT|@H"t&G@0H"'G4H"HH H"pH"4 4 H @HPBLzGpuG4(G:vGGloGXdrGlmH"t |LAGd(zEB 8{EGTGPH pE G+|GT>GT,G lDTyD  -GG;A# # Ht 4$ FLE|H"H"GH2`GxAE8T, ,\ `b@CTvX# GX$ H"HTLD"G@HAHH( H(H0H"H"(CHD@H"$HT+2ȄG@@H"GBCHQpH`XGBjqD~DBD0D H"l$ $G<%G`H# H( `H"pH(вC(Cx4<PH4F NLGZXCfCrC YD0HGhSHZX @c l vxGvGHt#  PFL$ TG$# `$ EF- GBhqFXEkE0EpCCA)HHXLG<HT H H H H HH  ( H4 H> H"J $ W pH"_ pH"f H"j PHLp H"z H( H" \#  @$  $  @ F sF ! H8 @6A![G!\G/!|]G$A!` XM!# U!H"[!1Gn!HPu!x$ ~!*A!0H"!H@"!H"!H"!H"!H!H"!- !?B|!T$ !# !`HT"tA"F 3"FJ"HXP"C^"YHm"UHD}"G@"TGp"\H"PvHX"vH"H"0\H"(^H"H""H"# #6#D# ^#P@g#  }# #H\#ܺHh#H#H#H#$H#H#DH#H #H#|H#ȳH# HH#TH#PH#(H$0Hp $Hp$PHp$A%$A,$@H3$ :$ >$H# E$H# Q$H# W$.  1fv _  \u0s3`hUYG~c@wM)fERXz,'YE'(>Y}=.  L3|;W9 ?He#m`8bTW0 v(r2xC'2>7:,H4dg S6^%~@R{#l0y}TE gJLQ.^53 a`l!8yi a!%xIGtP /+NenqwKfk*_LWun;Zs*?XAO/rB9"m"d)=xsOa+[C<i{G4O!C:$j @dU ^}>b<RAoKF_=qc&qJiHcy$P{5t]&N K.QS#1tIT7[,r+:7Bu?hoF61|l\5)|pDjmSM]V&b8j*<JQV ;wk-pvg -e"hVZM]o/F%-6~B4z$ZU29\DznPD[X(pkNAIHelpSelectExit%%%ss%%%sdYou have no aliases!AliasesAlias as: You already have an alias defined with that name!Address: Personal name: [%s = %s] Accept?Save to file: aalias %s Alias added.%s@%s%s/%srwCan't match nametemplate, continue?Mailcap compose entry requires %%sError running "%s"!Failure to open file to parse headers.Failure to open file to strip headers.No mailcap compose entry for %s, creating empty file.Mailcap Edit entry requires %%sbuiltinNo mailcap edit entry for %sMM_NOASK1,No matching mailcap entry found. Viewing as text.MIME type not defined. Cannot view attachment.openCannot create filter---Command: %-20.20s Description: %s---Command: %-30.30s Attachment: %s---Attachment: %s : %s---Attachment: %sfopenAttachment saved.afcloseWrite fault!stattext/plainapplication/postscriptI don't know how to print that!HelpMaskChdirExit%b %d %H:%M%b %d %Y%%%ss*/@%c%c%c%c%c%c%c%c%c%c%%%sld%%%sd%%%sc866666666<6666666666666666666666l66H60666666666666666%s is not a directory..%s/%s%2d %sMailboxes [%d]Directory [%s], File mask: %sNo files match the file mask../..%s/%sChdir to: Error scanning directory.File Mask: Reverse sort by (d)ate, (a)lpha, si(z)e or do(n)'t sort? Sort by (d)ate, (a)lpha, si(z)e or do(n)'t sort? dazn%s/New file name: Can't view a directoryError trying to view file66D6X6l66%s/newNew mail in %s.yellowwhiteredmagentagreencyanblueblackindexunderlineboldsearchattachmentmessagebodyheadermarkerstildenormalerrortreestatusindicatorsignaturequotedhdrdefaultbrightcolor%s: color not supported by term%s: no such color%s: no such object%s: command valid only for index objectuncolorunmono%s: too few arguments*Missing arguments.color: too few argumentsmono: too few argumentsnonereversestandout%s: no such attributetoo few argumentstoo many arguments%s/%sInvoking PGP...Verify PGP signature?wCould not create temporary file!builtin fclose%s %sError running "%s"!Command: Bounce message to: Bounce tagged messages to: Error parsing address!Bounce message to %sBounce messages to %s...?Message bounced.Messages bounced.Pipe to command: Rev-Sort (d)ate/(f)rm/(r)ecv/(s)ubj/t(o)/(t)hread/(u)nsort/si(z)e/s(c)ore?: Sort (d)ate/(f)rm/(r)ecv/(s)ubj/t(o)/(t)hread/(u)nsort/si(z)e/s(c)ore?: dfrsotuzc 57x57(57057857@57H57P57X57`57h57Shell command: :%s%s%s to mailboxDecode-saveDecode-copyDecrypt-saveDecrypt-copySaveCopy tagged.Copying to %s...Print message?Print tagged messages?Message printedMessages printedMutt %s (%s)1.0.1i/%s%s//...There are no attachments.Fcc: Reply-To: Subject: Bcc: Cc: To: From: HelpDescripAttach fileSubjCCToAbortSend PGP: Sign, EncryptEncryptSignClear%s%s sign as: MIC algorithm: Can't open your secret key ring!Sign as: 0x%sAn unkown PGP version was defined for signing.This doesn't make sense if you don't want to sign the message.pgp-md5pgp-sha1pgp-rmd160Unknown MIC algorithm, valid ones are: pgp-md5, pgp-sha1, pgp-rmd160(e)ncrypt, (s)ign, sign (a)s, (b)oth, select (m)ic algorithm, or (f)orget it? esabmf P7(P70P7 R7R7S7%s [#%d] no longer exists!%s [#%d] modified. Update encoding?%10s%-*.*s===== Attachments =====%-*.*sYou may not delete the only attachment.ComposebuiltinOpen mailbox to attach message fromNo messages in that folder.Tag the messages you want to attach!Unable to attach!Description: %s/%sContent-Type: charsetx-actionformatContent-Transfer-Encoding: Invalid encoding.Save a copy of this message?Rename to: Can't stat: %sNew file: Content-Type is of the form base/subUnknown Content-Type %swCan't create file %sWhat we have here is a failure to make an attachmentPostpone this message?%s -x %sError running "%s"!Write message to mailboxWriting message to %s ...Message written.g7g78`7H`7Ln7Ps7a7Xu7`7`c7b7`7a7X`7(`74p7w778z7x7w7t7`v7o777777777|m777777777777777777777777L7p777777777777777777777777777777777777777777777777p777777777_777H77777777777777777777777777De7777From Status:X-Status:Content-Length:Lines:Delivered-To:content-transfer-encoding:type:mime-version:Mime-Version: 1.0 Content-Transfer-Encoding: 8bit Content-Type: text/plain; charset=Status: ROX-Status: Content-Length: %ld Lines: %d Lines: %d Content-Type: message/external-body; access-type=x-mutt-deleted; expiration=%s; length=%ld Error running "%s"!yesno%s ([%c]/%c): Exit Mutt?%s: %s (errno = %d)unknown error/dev/ttyPress any key to continue... builtin ('?' for list): %s: No mailbox is open.There are no messages.Mailbox is read-only.Function not permitted in attach-message mode.Cannot toggle write on a readonly mailbox!Changes to folder will be written on folder exit.Changes to folder will not be written.HelpGroupReplyMailSaveUndelDelQuitMailbox was externally modified. Flags may be wrong.New mail in this mailbox.%-*.*sNo tagged messages.tag-Jump to message: Argument must be a message number.That message is not visible.Invalid message number.Delete messages matching: No limit pattern is in effect.Limit: %s%sLimit to messages matching: Quit Mutt?Tag messages matching: Undelete messages matching: Untag messages matching: Open mailbox in read-only modeOpen mailbox%s is not a mailbox.Exit Mutt without saving?You are on the last message.No undeleted messages.You are on the first message.Search wrapped to top.Search wrapped to bottom.%s%s.No new messagesNo unread messages in this limited viewNo more threads.You are on the first thread.Thread contains unread messages.Threading is not enabled.T78\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8t78777t7t7888877, 8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8|8\87\8t77 8\8 87777t7 8\8 807D777\8\8\87777l7777777|8|87p7t77777747\8\8\8\8\8877T788\87847\88t7`7`7`7`7\88777\8H8H87(7\87t8888\887D7x7\8\8`8 88\8\8t7t7~~ insert a line begining with a single ~ ~b users add users to the Bcc: field ~c users add users to the Cc: field ~f messages include messages ~F messages same as ~f, except also include headers ~h edit the message header ~m messages include and quote messages ~M messages same as ~m, except include headers ~p print the message ~q write file and quit editor ~r file read a file into the editor ~t users add users to the To: field ~u recall the previous line ~v edit message with the $visual editor ~w file write message to file ~x abort changes and quit editor ~? this message . on a line by itself ends input r"%s" %lu bytes %s: %s wfclose: %s , %d: invalid message number. To: Cc: Bcc: Subject: (End message with a . on a line by itself) %dNo mailbox. ----- Message contains: (continue) missing filename. No lines in message. %s: unknown editor command (~? for help) .t48;8;8;8;8;8;8|58;8;8;8;8;8;8|58;8;8;8;8;8;8;8;8;8;8;8;8;8;8;8;8;8;8;8;84848;898|58;8P58;8;8;8;8|58;8;868;878p88889898X;8;80A8B8A8D8E8H8TC80B8B8@8@8B8|B8C8`I8dN8-(%P)---status_format-*%Astatus_charsspoolfilesort_resort_browsersort_auxsort_aliassort(>From )|(:[-^]?[][)(><}{|/DP])smileyssmart_wrap~f %s | ~s %ssimple_search~/.signaturesignaturesig_dashesshellsendmail_wait/bin/sendmail -oem -oisendmailsave_namesave_emptysave_addressreverse_namereverse_aliasresolvereply_toreply_selfrecordrecallrealnameread_onlyread_inc^(re([\[0-9\]+])*|aw):[ ]*reply_regexp^([ ]*[|>:}#])+quote_regexpquitquery_commandprompt_afterprint_cmdlprprint_commandprint~/postponedpostponedpostponepost_indent_strpost_indent_stringpipe_seppipe_decodepipe_splitforw_decryptforward_decryptpgp_key_versionpgp_send_versiondefaultpgp_receive_versionpgp_gpgpgp_v6_secringpgp_v6_pubringpgp_v6_languagepgp_v6pgp_v5_secringpgp_v5_pubringpgp_v5_languagepgp_v5pgp_v2_secringpgp_v2_pubringenpgp_v2_languagepgp_v2pgp_verify_sigpgp_timeoutpgp_strict_encpgp-md5pgp_sign_micalgpgp_sign_aspgp_replysignpgp_replyencryptpgp_long_idspgp_encryptselfpgp_autoencryptpgp_autosignpager_stoppager_index_lines-%S- %C/%m: %-20.20n %spager_formatpager_contextbuiltinpagermsg_format%smessage_formatmovemime_fwdmime_forward_decodemime_forwardmh_purgemeta_keymenu_scrollmetoombox_type~/mboxmbox!^\.[^.]maskmarkersmark_oldmailcap_sanitizemailcap_pathmail_checkClocale/usr/bin/ispellispellignore_list_reply_to%4C %Z %{%b %d} %-15.15L (%4l) %sindent_str> indent_stringinclude%i; from %a on %{!%a, %b %d, %Y at %I:%M:%S%p %Z}in_reply_toimplicit_autoviewhostnamehistoryhidden_hosthelpheaderhdrsindex_formathdr_formatforw_quoteforward_quoteforw_format[%a: %s]forward_formatforw_weedforward_weedforw_decodeforward_decodeforce_namefollowup_to%N %F %2l %-8.8u %-8.8g %8s %d %ffolder_format~/Mailfolderfcc_attachfast_reply~escapeeditoredit_hdrsedit_headersdsn_returndsn_notifydelete~f %s !~P | (~P ~C %s)default_hook!%a, %b %d, %Y at %I:%M:%S%p %Zdate_formatcopyconfirmcreateconfirmappenduncollapse_jumpcollapse_unreadcheck_newiso-8859-1charsetbounce_deliveredbeep_newbeepauto_tagautoeditOn %d, %n wrote:attribution attach_sepattach_split%u%D%t%2n %T%.40d%> [%.7m/%.10M, %.6e, %s] attach_formataskccaskbccascii_charsarrow_cursoralternatesallow_8bit%2n %t %-10a %ralias_format~/.muttrcalias_fileabort_unmodifiedabort_nosubjectscoretothreadssizefromsubjectmailbox-orderdate-receiveddate-sentdateunsortedalphaaddressaliasunsetunscoreunmy_hdrunmonounlistsunignoreunhdr_orderunaliastogglesourcesetsend-hooksave-hookresetpushpgp-hookmy_hdrmonombox-hookmailboxesmacrolistsignorehdr_orderfolder-hookfcc-save-hookfcc-hookexecuncolorcolorbindalternative_orderauto_view~!|\`@^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8@^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8^8* alias: no address: invalid header fieldignoring empty header field: %sreverse-last-%s: unknown sorting methodmutt_restore_default: error in regexp: %s u8v8 blackredgreenyellowbluemagentacyanwhite8h8888`88%s/%splainenrichedhtml[-- Error: Could not display any parts of Multipart/Alternative! --] signedencryptedboundarydigest[-- Attachment #%d: --] [-- Type: %s/%s, Encoding: %s, Size: %s --] Content-Description: %s %s: [-- Autoview using %s --] Invoking autoview command: %sw+fopen[-- Autoview stderr of %s --] access-type[-- Error: message/external-body has no access-type parameter --] expirationx-mutt-deleted[-- This %s/%s attachment length(size %s bytes) has been deleted --] [-- on %s --] [-- This %s/%s attachment is not included, --] [-- and the indicated external source has --] [-- expired. --] [-- This %s/%s attachment is not included, --] [-- and the indicated access-type %s is unsupported --] rfc822-headersdelivery-statusexternal-bodyalternativeprotocolError: multipart/signed has no protocol.application/pgp-signatureError: multipart/encrypted has no protocol parameter!application/pgp-encryptedwUnable to open temporary file!r[-- %s/%s is unsupported (use '%s' to view this part)(need 'view-attachments' bound to key!)%s%s%sTo Cc To %sCc %s%%%ss(null)%%%sd%c%02u%02uC%@ %%%sc %@%c%c%c%%%s%c'9:9:9:9:9:9:9:9:9:9:9:9:9:9:9:9:9:9:9:9'9:9:9:9:9:98%90'9'9:9X,9:9:9:9:9:9h-9090/9/9:9:9:9 3959:9:9:9:9:979'9:9:9:9:9:9$9 &9&9'9:9+9:9:9,9:9:9-9D.9.9:9:9:9:919395969:9:9:9:9'9wrin-reply-to:fcc:attach: %s: unable to attach filepgp:make decrypted copymake decrypted copy and deleteview the key's user idverify a PGP public keymail a PGP public keywipe PGP passphrase from memoryextract PGP public keysshow PGP optionsattach a PGP public keycollapse/uncollapse all threadscollapse/uncollapse current threadshow currently active limit patternshow MIME attachmentsview attachment using mailcap entry if necessaryshow the Mutt version number and dateundelete all messages in subthreadundelete all messages in threadundelete the current entrymove to the top of the pagetoggle whether to browse mailboxes or all filestoggle whether the mailbox will be rewrittentoggle a message's 'new' flagtag the current threadtag the current subthreadapply next function to tagged messagestag the current entrysort messages in reverse ordersort messagesinvoke a command in a subshelltoggle search pattern coloringsearch for next match in opposite directionsearch for next matchsearch backwards for a regular expressionsearch for a regular expressionsave message/attachment to a filereply to a message{internal}clear and redraw the screenrecall a postponed messagesave changes to mailbox and quitappend new query results to current resultsquery external program for addressesprint the current entrymove to the previous pagescroll up one linemove to the previous entrypipe message/attachment to a shell commandjump to the top of the messageskip beyond quoted texttoggle display of quoted textreturn to the main-menujump to the bottom of the messagemove to the next pagescroll down one linemove to the next entrymove to the middle of the pageuntag messages matching a patternundelete messages matching a patterntag messages matching a patternsave changes to mailboxset a status flag on a messagemark the current subthread as readmark the current thread as readjump to the previous unread messagejump to the previous new messagemove to the last undelete messagejump to previous subthreadjump to previous threadjump to the next unread messagemove to the next undeleted messagejump to the next threadjump to the next subthreadjump to the next new messageshow only messages matching a patternmove to the last messagemove to the first messageretrieve mail from POP serverdelete messages matching a patternclear a status flag from a messageopen a different folder in read only modeopen a different foldercompose a new mail messageexecute a macroreply to specified mailing listmove to the last entryjump to an index numberthis screenscroll up 1/2 pagescroll down 1/2 pagereply to all recipientsselect the current entryforward a message with commentstoggle a message's 'important' flagmove to the first entryfilter attachment through a shell commandexit this menuenter a file maskenter a muttrc commandquote the next typed keydelete the word in front of the cursordelete all chars on the linedelete chars from cursor to end of linescroll up through the history listmove the cursor one character to the rightjump to the end of the linedelete the char under the cursorcomplete address with querycomplete filename or aliascycle among incoming mailboxesjump to the beginning of the linemove the cursor one character to the leftdelete the char in front of the cursoredit the current message for resendingdisplay a messagedisplay message with full headersdisplay full address of senderdelete all messages in threaddelete all messages in subthreaddelete the current entrymake decoded copy (text/plain) and deletemake decoded (text/plain) copymove entry to top of screenmove entry to middle of screenmove entry to bottom of screencreate an alias from a message sendercopy a message to a file/mailboxwrite the message to a folderupdate an attachment's encoding infotoggle whether to delete file after sending itsend the messagerename/move an attached filesave this message to send latercompose new attachment using mailcap entryrun ispell on the messageget a temporary copy of an attachmentedit attachment typeedit the TO listedit the subject of this messageedit the Reply-To fieldedit attachment using mailcap entryedit the messageedit the message with headersedit the from fieldedit the file to be attachedenter a file to save a copy of this message inedit attachment transfer-encodingedit attachment descriptionedit the CC listedit the BCC listattach message(s) to this messageattach a file(s) to this messagecheck mailboxes for new mailchange directoriesdisplay the currently selected file's nameview fileselect a new file in this directoryremail a message to another usermove to the bottom of the pageview attachment as textforce viewing of attachment using mailcapnull operation%s:%s%%-%dsbuiltin_M ...macroUNKNOWNERROR: please report this bugw Generic bindings: Unbound functions: Help for %stoo few argumentstoo many arguments%s=%s%s/%scurrent-bottomcurrent-middlecurrent-topjumpsearch-opposite/search-reverse/search select-entry!shell-escape;tag-prefix?help]half-down[half-up<previous-line>next-line:enter-command=first-entry*last-entryZprevious-pageznext-pagettag-entryqexitnsearch-nextMmiddle-page refreshLbottom-pagekprevious-entryjnext-entryHtop-pagedecrypt-savedecrypt-copykmail-keyforget-passphrase extract-keysprevious-unreadnext-unread previous-new next-new|pipe-message@display-address$sync-mailboxdisplay-messageWclear-flagwset-flagVshow-versionvview-attachmentsundelete-threaduundelete-subthreadUundelete-patternuundelete-messageuntag-patternttag-threadtag-subthreadTtag-patternssave-messagerread-subthreadread-threadRrecall-messagepprevious-subthreadprevious-threadpprint-messageOsort-reverseosort-mailboxlshow-limitrreplyquitQquerynnext-subthreadnext-thread%toggle-writeNtoggle-newmmaillist-replyllimitprevious-undeletednext-undeletedhdisplay-headersggroup-replyFflag-messagefforward-messageeeditddelete-subthreaddelete-threadDdelete-patternddelete-messagesdecode-saveCdecode-copyCcopy-messageVcollapse-allvcollapse-threadcchange-folder-readonlycchange-folderbbounce-messageacreate-aliasbottom^top- \search-toggletoggle-quotedtag-messageSskip-quotedmark-as-newredraw-screenKJiundelete-entrydelete-entryview-attachview-textview-mailcappipe-entrysave-entryprint-entrypgp-menuattach-keyysend-messageupdate-encodingtoggle-unlinkwrite-fccedit-typeedit-toedit-subjectrename-fileedit-reply-toPpostpone-messagenew-mimeedit-mimeispellGget-attachmentfilter-entryedit-fccfedit-fromedit-encodingeedit-fileEedit-headersedit-messageedit-descriptiondetach-filecopy-fileedit-ccedit-bccAattach-messageattach-fileview-filetoggle-mailboxescheck-newselect-newsortenter-maskdisplay-filenamechange-dirquery-appendhistory-downhistory-upbuffy-cyclecomplete-querycompletekill-wordquote-charkill-linekill-eolbackspaceforward-chareoldelete-charbackward-charbolview-nameverify-keygenericpgppostponepagerindexeditorcomposebrowserattachaliasMacro loop detected.\%d%d%d%c\x%hx123456789xKey is not bound.Key is not bound. Press '%s' for help.push: too many arguments%s: no such menunull key sequencetoo few arguments099D99̍9999l9X9bind: too many argumentsnoop%s: no such function in mapmacro: empty key sequencemacro: too many argumentsexec: too few arguments%s: no such commandSatFriThuWedTueMonSunERRDecNovOctSepAugJulJunMayAprMarFebJanvideotextmultipartmodelmessageimageapplicationaudiox-unknownx-uuencodedbinarybase64quoted-printable8bit7bit2000-01-18To contact the developers, please mail to . Copyright (C) 1996-2000 Michael R. Elkins and others. Mutt comes with ABSOLUTELY NO WARRANTY; for details type `mutt -vv'. Mutt is free software, and you are welcome to redistribute it under certain conditions; type `mutt -vv' for details. Copyright (C) 1996-2000 Michael R. Elkins Copyright (C) 1997-2000 Thomas Roessler Copyright (C) 1998-2000 Werner Koch Copyright (C) 1998-2000 Ruslan Ermilov Lots of others not mentioned here contributed lots of code, fixes, and suggestions. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. SHA1 implementation Copyright (C) 1995-1997 Eric A. Young Redistribution and use in source and binary forms, with or without modification, are permitted under certain conditions. The SHA1 implementation comes AS IS, and ANY EXPRESS OR IMPLIED WARRANTIES, including, but not limited to, the implied warranties of merchantability and fitness for a particular purpose ARE DISCLAIMED. You should have received a copy of the full distribution terms along with this program; if not, write to the program's developers. Mutt %s (%s) 1.0.1iusage: mutt [ -nRzZ ] [ -e ] [ -F ] [ -m ] [ -f ] mutt [ -nx ] [ -e ] [ -a ] [ -F ] [ -H ] [ -i ] [ -s ] [ -b ] [ -c ] [ ... ] mutt [ -n ] [ -e ] [ -F ] -p mutt -v[v] options: -a attach a file to the message -b
specify a blind carbon-copy (BCC) address -c
specify a carbon-copy (CC) address -e specify a command to be executed after initialization -f specify which mailbox to read -F specify an alternate muttrc file -H specify a draft file to read header from -i specify a file which Mutt should include in the reply -m specify a default mailbox type -n causes Mutt not to read the system Muttrc -p recall a postponed message -R open mailbox in read-only mode -s specify a subject (must be in quotes if it has spaces) -v show version and compile-time definitions -x simulate the mailx send mode -y select a mailbox specified in your `mailboxes' list -z exit immediately if there are no messages in the mailbox -Z open the first folder with new message, exit immediately if none -h this help messageSystem: %s %s [using ncurses %s]1.9.9g Compile options:-DOMAIN-HOMESPOOL +USE_SETGID +USE_DOTLOCK +USE_FCNTL -USE_FLOCK-USE_IMAP -USE_POP +HAVE_REGCOMP -USE_GNU_REGEX +HAVE_COLOR -BUFFY_SIZE -EXACT_ADDRESS -ENABLE_NLSSENDMAIL="%s" /bin/sendmailMAILPATH="%s" /var/spool/mailSHAREDIR="%s" //lib/muttSYSCONFDIR="%s" //etcISPELL="%s" /usr/bin/ispell_PGPPATH="%s" /usr/bin/pgp_PGPV2PATH="%s" _PGPV3PATH="%s" Error initializing terminal.%s: I don't want to run with privileges! a:b:F:f:c:d:e:H:s:i:hm:npRvxyzZDEBUG was not defined during compilation. Ignored. No recipients specified. -rw%s: unable to attach file. No mailbox with new mail.Mailbox is empty.p99 9999999999l999999999999999D999̟99̞99949999H9\99d999t99999999  Mailbox is corrupt!Reading %s... %d (%d%%)From rMailbox was corrupted!r+Fatal error! Could not reopen mailbox!Unable to lock mailbox!wCould not create temporary file!sync: mbox modified, but no modified messages! (report this bug)Writing messages... %d (%d%%) %s/mutt.%s-%s-%dWrite failed! Saved partial mailbox to %sCould not reopen mailbox!Reopening mailbox... 9X999989L9`9t9%-*.*s-- Mutt: %s-> Jump to: Invalid index number.No entries.You cannot scroll down farther.You cannot scroll up farther.You are on the last page.You are on the first page.First entry is shown.Last entry is shown.You are on the last entry.You are on the first entry.Search for: Reverse search for: No search pattern.%sNot found.Tag-No tagged entries.Search is not implemented for this menu.Tagging is not supported.$ :D :D ::D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :X:0::D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :4:D :D :D :@:D :D :D :D :P:x: : :h:D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :D :::::D :D :D :D :D :D :(:::D :D :D :D :D : :D :D :D :::::D : :D :D ::D :D :D :D :D :D ::2,%s/%scurnewr%s/%s/%sReading %s... %d%s/.mutt-%s-%d-%dw:2,%s%s%sFRS%s/tmp/%s.%ld.%d_%d.%s%s%s/%ld.%d_%d.%s%s%d%s/%s%srename%s/,%s%s/new%s/curcur/new/-r %d %s %s%s%s%s%s%s%s//bin/mutt_dotlock-t -u -p -f -d Lock count exceeded, remove lock for %s?Can't dotlock %s. fcntlTimeout exceeded while attempting fcntl lock!Waiting for fcntl lock... %d%s/cur%s/.mh_sequences%s/.xmhcacherFrom  mboxmmdfmhmaildirkendra%s is not a mailbox.%s/new%s/tmpaReading %s...Writing %s...Move read messages to %s?Purge %d deleted message?Purge %d deleted messages?Moving read messages to %s...Mailbox is unchanged.%d kept, %d moved, %d deleted.%d kept, %d deleted. Press '%s' to toggle writeUse 'toggle-write' to re-enable write!Mailbox is marked unwritable. %sMailbox is read-only.From %s %s%s/%s d:d:d:Pe:e:Not available in this menu.Mailbox is read-only.Function not permitted in attach-message mode.[-- -- -- NextPgPrevPgExitNextReplyDelView Attachm.r Help%-*.*s%-*.*s -- (%d%%)all)end)Bottom of message is shown.Top of message is shown.Not found.Reverse search: Search: %sHelp is currently being shown.No more quoted text.No more unquoted text after quoted text.:T:T:T: :T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T::T:T:T:T:T:ĺ:::t:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T::T:T:T:T:::T:::Ȯ::T:T:$:T:<:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:T:::ĸ:|:t:ض:::T::::T:T:T:0::T:::D:D:`:`::H:T:T::T:T:T::T:T:T:::::T::T:T:T:T:T:::8:T:T::T: 7bit8bitbinaryquoted-printablebase64x-uuencode=;textmultipartapplicationmessageimageaudiovideomodelnameplainbasicrfc822x-%sx-unknowninlineform-datafilenamecontent-typetransfer-encodingdispositiondescriptionboundarydigestexternal-bodymultipart message has no boundary parameter!-- )%d:%d:%d%d:%dMETDST:@:h::D:: >From pparently-topparently-fromcccontent-lengthatexpiresromn-reply-toinesime-versionessage-idail-reply-tofollowup-toeferenceseply-toeturn-patheceivedubjectendertatusupersedesupercedeso-status::D:<::h:`;`;:`;`;D::`;`;`;`;4::$:`;`;`;|:"<>():;,\w+Error in expression: %sInvalid day of month: %sInvalid month: %serror in expression<>=error in pattern at: %s%c: invalid command%c: not supported in this modemissing parametermismatched parenthesis: %sempty patternerror: unknown op %d (report this error).$;);P$;$;$;%;$;););$%;0$;@$;););$; $;#;#;t&;&;H);&;4&;t%;%; ';%;%;%;%;4%;l';';';|(;(;(;);(;x);););all^.~Adel~Dflag~Fnew~Nold~Orepl~Qread~Rtag~Tunread~UCompiling search pattern...%sExecuting command on matching messages...No messages matched criteria.Search for: Reverse search for: No search pattern.Search wrapped to top.Search hit bottom without finding matchSearch wrapped to bottom.Search hit top without finding matchSearch interrupted.Not found.HelpUndelDelExit%s/newPostponed MessagesNo postponed messages.X-Mutt-References:X-Mutt-Fcc:Pgp:Illegal PGP headerH;I;I;I;I;I;I;I;DI;I;I;I;I;I;H;I;I;I;I;I;I;I;I;I;I;I;I;I;I;I;I;I;H;I;I;I;I;I;I;I;DI;I;I;I;I;I;H;HelpSearchMake AliasNew QueryMailExitWaiting for response... %c %3d %-*.*s %-*.*s %sQuery command not defined.QueryQuery: Query '%s', Mailbox is read-only.HelpPrintPipeSaveExit%%%ss%c%%%sd`j;ln;ln;ln;ln;ln;ln;ln;ln;k;ln;ln;ln;ln;ln;ln;lm;ln;ln;ln;ln;ln;ln;ln;ln;ln;ln;ln;ln;ln;ln;ln;g;j;i;ln;ln;ln;ln;ln;ln;k;k;ln;ln;ln;ln;Xl;(m;m;rfc822newsSave to file: Saving...Attachment saved.a%sAttachment savedWARNING! You are about to overwrite %s, continue?Attachment filtered.rfopenFilter through: Pipe to: %s/%stext/plainapplication/postscriptI dont know how to print %s attachments!Print tagged attachment(s)?Print attachment?You may only bounce message/rfc822 parts.Bounce message to: Bounce tagged messages to: Bounce messages to %s...?Bounce message to %s...? --%s boundary--%s-- Mime-Version: 1.0 Function not permitted in attach-message mode.AttachmentsDeletion of attachments from PGP messages is unsupported.Only deletion of multipart attachments is supported.This operation is not currently supported for PGP messages.\;;ܓ;D;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;;ܓ;ܓ;ܓ;,;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;@;ܓ;ܓ;ܓ;Ԛ;ܓ;Ԛ;ܓ;ܓ;ܓ;ܓ;ܓ;Ԛ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;;ܓ;ܓ;ܓ;L;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;Ԛ;0;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;;ܓ;ܓ;ܓ;,;ܓ;ܓ;ܓ;ܓ;ܓ;ܓ;;@.,:;<>[]\"()bad address specbad address in <>bad route in <>mismatched quotesmismatched parenthesisout of memory."(\.([]\.\[](%s@%s;\Improperly formated entry for type %s in "%s" line %dr/*needsterminalcopiousoutputcomposetypedcomposeprinteditnametemplatex-converttestNo mailcap path specifiedmailcap entry for type %s not found%s/muttXXXXXX%s/%s%s/%s.XXXXXXmutt%s%s%swus-asciiunknown-8bit=?%s?Q?=?us-ascii?Q??= =%02X?==?%s?B?iso-8859re: fwd: ?=? score: too few argumentsscore: too many arguments* -- To: Cc: Bcc: subject:Subject: No subject, abort?No subject, aborting.to:cc:bcc:from:reply-to:----- Forwarded message from ----- ----- End forwarded message ----- Reply to %s%s?,...No tagged messages are visible!No mailing lists found!Re: %sRe: your mailIn-Reply-To: Include message in reply?Could not include all requested messages!Forward MIME encapsulated?%s@%swRecall postponed message?a+plainw+builtinAbort unmodified message?Aborted unmodified message.Mail not sent.Message postponed.No recipients are specified!No recipients were specified.No subject, abort sending?No subject specified.Message edited. Really send?Sending message.../dev/nullencryptedsignedCould not send the message.Mail sent.Sending in background.Exec error.Local configuration error.Insufficient permission.Remote protocol error.Deferred.I/O error.Can't create output.System file missing.Operating system error.Internal error.Service unavailable.Host unknown.User unknown.Cannot open input.Data format error.Bad usage.@.,;<>[]\"()?/= From =46rom =2E= =%2.2X =%2.2XContent-Type: %s/%sboundary"%s" %s=%sContent-Description: %s Content-Disposition: %sattachmentinline; filename=%sContent-Transfer-Encoding: %s No boundary parameter found! [report this error] --%s --%s-- pgp-encryptedVersion: 1 r%s no longer exists!%s/.mime.types//etc/mime.types//lib/mutt/mime.types us-asciiunknown-8bitCould not open %s(null)statw+fopenMime-Version: 1.0 wHzG?@charsetrfc822plainoctet-streammixedDate: %s, %d %s %d %02d:%02d:%02d %+03d%02d Date: %s From: %s To: To: Cc: Cc: Bcc: Bcc: Subject: %s Subject: Message-ID: %s Reply-To: Reply-To: Mail-Followup-To: References:X-Mailer: Mutt %s 1.0.1i%s: <%d%02d%02d%02d%02d%02d.%c%d@%s> -B8BITMIME-N-R--Error sending message, child exited %d (%s).Output of the delivery process@.+-_,:undisclosed-recipientsResent-From: %s@%s Resent-%sResent-To: X-Mutt-References: %s X-Mutt-Fcc: %s Status: RO Pgp: <%s>M<%s>Content-Length: %ld Lines: %d %s... Exiting. %@<=L=L=L=L=L=L=L=$=L=L=L=4=L=,=L=D=r%s is not a mailbox!Append messages to %s?Create %s?gpgpgp6pgp5pgp3pgp2Enter PGP passphrase:PGP passphrase forgotten.defaultUnknown PGP version "%s".[-- PGP output follows (current time: ) --] -----BEGIN PGP MESSAGE----- SIGNED MESSAGE----- PUBLIC KEY BLOCK----- w+-----END PGP MESSAGE----- -----END PGP SIGNATURE----- -----END PGP PUBLIC KEY BLOCK----- [-- Error: unable to create PGP subprocess! --] [-- End of PGP output --] [-- BEGIN PGP MESSAGE --] [-- BEGIN PGP PUBLIC KEY BLOCK --] [-- BEGIN PGP SIGNED MESSAGE --] -----BEGIN PGP SIGNATURE----- [-- END PGP MESSAGE --] [-- END PGP PUBLIC KEY BLOCK --] [-- END PGP SIGNED MESSAGE --] [-- Error: could not find beginning of PGP message! --] signedprotocolapplication/pgp-signatureencryptedapplication/pgp-encryptedpgpx-pgp-messagex-actionsignsignclearformatkeys-onlypgp-signedpgp-keyspgp-signaturew%s.asc[-- End of PGP output --] [-- The following data is PGP/MIME signed --] [-- End of PGP/MIME signed data --] [-- Error: this message does not comply with the PGP/MIME specification! --] Internal error. Inform .[-- Error: could not create a PGP subprocess! --] pgp-encryptedoctet-stream[-- Error: malformed PGP/MIME message! --] [-- Error: could not create temporary file! --] [-- The following data is PGP/MIME encrypted --] [-- End of PGP/MIME encrypted data --] delivery-statusCan't open PGP subprocess!-----BEGIN PGP MESSAGE----- fclosemicalgUse keyID = "%s" for %s?Enter keyID for %s: %s0x%s Invoking PGP...%scat %s%s | %s +language=%s +pubring=%s +secring=%s +verbose=0 +batchmode -fPGPPASSFD=0; export PGPPASSFD; - %s +language=%s +pubring=%s +secring=%s +batchmode +verbose=0 %s %sPGPPASSFD=0; export PGPPASSFD; cat - %s | %s +language=%s +pubring=%s +secring=%s +verbose=0 +batchmode -fPGPPASSFD=0; export PGPPASSFD; cat - %s | %s +language=%s +pubring=%s +secring=%s +verbose=0 +batchmode -abfst %s %s-u%scat %s%s | %s +language=%s +pubring=%s +secring=%s +verbose=0 %s +batchmode -aeft%s %s%s %s+encrypttoselfs-u %s +language=%s +pubring=%s +secring=%s -ka %s%s -kxaf +language=%s +pubring=%s +secring=%s 0x%8s%s +language=%s +pubring=%s +secring=%s +batchmode -kcc 0x%8s%scat %s%s | %sv +language=%s +pubring=%s +secring=%s +verbose=0 +batchmode -f --OutputInformationFD=2%sv +language=%s +pubring=%s +secring=%s --OutputInformationFD=1 +batchmode +verbose=0 %s %s%scat %s%s | %se +language=%s +pubring=%s +secring=%s +verbose=0 %s +batchmode +nobatchinvalidkeys=off -aft%s %s%s %s -r %sPGPPASSFD=0; export PGPPASSFD; cat - %s | %sv +language=%s +pubring=%s +secring=%s +verbose=0 +batchmode -f --OutputInformationFD=2PGPPASSFD=0; export PGPPASSFD; cat - %s | %ss +language=%s +pubring=%s +secring=%s +verbose=0 -abft %s %s%sk +language=%s +pubring=%s +secring=%s -a --OutputInformationFD=1 %s%sk -xa +language=%s +pubring=%s +secring=%s --OutputInformationFD=1 0x%8s%sk +language=%s +pubring=%s +secring=%s +batchmode -c --OutputInformationFD=1 0x%8sPGPPASSFD=0; export PGPPASSFD; cat - %s | %s +language=%s +pubring=%s +secring=%s +verbose=0 +batchmode +pgp_mime=off -abfst %s %s%scat %s%s | %s +language=%s +pubring=%s +secring=%s +verbose=0 %s +batchmode +pgp_mime=off -aeft%s %s%s %s%s -kxaf +pgp_mime=off +language=%s +pubring=%s +secring=%s 0x%8s%s%s --no-verbose --batch -o - %s --passphrase-fd 0%s --no-verbose --batch -o - --verify %s %s%s --passphrase-fd 0 --no-verbose --batch -o - --decrypt %spgp-md5%s --no-verbose --batch -o - --passphrase-fd 0 --digest-algo %s --detach-sign --textmode --armor %s%s %s%s%s --no-verbose -v --batch -o - --digest-algo %s --encrypt%s --textmode --armor --always-trust %s%s --sign%s %s%s --no-verbose --import -v %s%s --no-verbose --export --armor 0x%8s0x%s --no-verbose --batch --fingerprint --check-sigs %s%s%4d %c%c %4d/0x%s %-4s %2s %sExit Select Check key HelpPGP keys matching /dev/nullwCan't open /dev/nullCan't create temporary fileInvoking PGP...Can't create filterKey ID: 0x%sThis ID's trust level is undefined.This ID is not trusted.This ID is only marginally trusted.%s Do you really want to use it?Please enter the key ID: apgp-keysPGP Key 0x%s.0xComment PacketReservedSubkey PacketName PacketTrust PacketLiteral Data PacketMarker PacketSymmetrically Encrypted Data PacketCompressed Data PacketSecret Subkey PacketPublic Key PacketSecret Key PacketOne-Pass Signature PacketConventionally Encrypted Session Key PacketSignature PacketEncrypted Session KeyreservedRSAElGDSAunkd=d=d=============x====x=x-unknownpgp-sha1pgp-rmd160pgp-md5reallocfread%08lX4=T======t================rfopenENCRSIGN(=<=<====<=<=<=<=X===SHA1 part of SSLeay 0.8.1 19-Jul-1997pubsubsecssb>>|>>>>>>>4>><>t>>>>>>>l>d>>>>P>>>t>%s --no-verbose --batch --with-colons --list-%skeys secret- %s %s/dev/nullfgets/dev/ttyLINESCOLUMNS< y'!'d@d !9' @9'  ''@$! Ԁ (!0@;9' *@$$Ԁ (!0@;9' @$0b @!0d!8 !@`$!( 0''!' P!D!@!H!L$X@TB@! @$  !@ ah$  !`  /('!($  @! B@,'!0!8$ȁ  !@,'!0!8܁  !@! ('(  ,R $g$  !@ di$  a@!B@! `ā  ! @  P!@! B@8'!0!8$ȁ  !@8'!0!8܁  !@8! P  8  !   @! B@! `ā  ! ́  @! B@B0@$Ё  $XPLHD@`'! 8$ CLk$!C!C B $p !  @@! !(@$ @' 8^Bl$!@ pld`\XTPLHx'<'!' !!($U[b!( ! @!0 'E$Ѐ '$ 8@\@$E' @C`P$@$$ ' b@@$ b@$`;$b#$( !0'< '!'\B8!LHD@@<!! !(@ B$Bc#*C@ B$Bԁ !$% !$ !$  'H @\$.$'H @ @t  @ ԁB@B @b(ob k`b(@b(g@$*XP* @[@` C D B$BB$ !$"G@`XbP>b< b'$l$p  '$Ѐ 'H !@ !  P @!  BS B$BB$ !$"` @  @ B$BB$ !$"L c$c B$B !$#LD@<8P'<'!'! $ $9' D@! B$B=@!\2$*@ &@'$Ѐ 'd l$'  c$c c$ !$# $ !$ !$('( 6, .0 &4 ԁB @  ܄$8B@8|B@!bbB0@!(  4~$ '$!8耙 @ @ |c@!CBB0 @ 'BH~$!@ < !@O ԁc8d*F@0&*@! ` !CB,BW&8*@!8*@0&ԁB C!Cb,BW&c$ ԁB C!CB,B Bl~$!@ wB~$!@ kԁc `  ܄$8b @XbB0 @  ܄$ BB0 @ $  ܄$~$@ $D ԁ   ܄$8@ '~$ ! $~$p ~$!( ԁ   ܄$8@<@$ B0!CB !CB$C$0 $~$<C@ @<e#ԁB w<D!!8`!0!( D0Cb!DB$BF1&*%@c$ bA!( `!(ԁ $IH ug $$肙  $eIԁV􁙏 O@ $H$| =ԁB @  ܄$ 8B @!( DL W b<b' b$$b:,P @ԁB@8B@$^9' >ԁc `  ܄$ 8b @XbB0 @!  ܄$  B<r@! !(@ d0cb!DBBB0@1&&*@c$ԁT @ԁB<BR b#Q b BB4 " C `ԁB<B*b @$\9'  bԁBBu @ԁ m ԁc `  ܄$) 8b @,BB0%@<b @!ԁ$0!CB  $!CE!8 ԁB<B&* @ԁ B0!CB !CC$g $EB908 $B B00@ԁB<B B$*b&@b$ $ ԁB @  ܄$ 8B @$$@ { ԁc `  ܄$ 8b @XbB0 @ $  ܄$~ 4$@ I @ ԁB @  ܄$` 8BR @$T$ R$R$R$BB0@ 'p& '& X !  '$ $$X l W @ '!0 $$ ( P $  't @ '$B!@ 5 ԁB(@$\ ԁBD ԁ\"􁙏  @ԁ $`  'd BB0@$R$!($ '!0聙 ԁ @"$\9'  b @d $D ^ BB4  "ԁB @  ܄$o 8Ba @.$ $c$bB8b B4cB0c0@i "ԁ B0!CB !CEB0,@$ ԁĄ BB0@$ԁ B0!CB !CE  bԁ B0!CB !CDh !@ $ BB09  " DC<DB $- I  $$$肙  $ Iԁ̃ ԁ  $ ԁc `  ܄$ 8b @<b B$*@ $,$l[9' YW `ԁc `  ܄$ 8b| @<b B$*b@b$ $ IB$!@  1 ԁB @  ܄$Z 8BL @ D<$[9'  W < $ i B$!@ u ԁB @  ܄$# 8B @ @ $W IB $!@ I B$ԁ   ܄$ 8 @!( B0!CB !CD$! $$)$&$&,`&,B$l  @$)$$ bB4 bB B0@ D$l[9' W bB4 bԁc `  ܄$ 8b~ @ Q W<b@!]$b$Y $ԁB<B1&B$*Q@,$ !1&!D$ ԁB<BQ$4B $B0;Iԁ0!CB !CEB0,@$ Y $$ 5@Y $a$4ԁ0!CB !CE$  $Iԁ0!CB !CBC@b0 @BB0@  QԁB<B&qY $ WY $< `$a$h$x$ԁBB|$@$B!@ ԁ   ܄$8@XB0 @$  ܄$ B0!CB !CCg $E908 B B0@ D$l[9' W <$ ԁ   ܄$R8D@XB0 @  ܄$<0< @!ԁ0!CB !(CCBB0@b0@ $$ $!8  ԁB<B&*@ B0!CB !(CBB0@ $$ $!8  B B0@@ D$l[9' sW /$ԁ   ܄$8@$]9' @ԁ   ܄$8@[$\*@Z$9^$_$ !(2$ B0!CB !CD!0$!( B0!CB !CD !0 B0!CB !CD$p  b A< &B, @B$!@ B$!@ }$b$wԁ   ܄$%8@XB0 @  ܄$e: B0!CB !CD,! ,t 7@$b $1iB B0@$ d$l[9' W <B4 B4bԁ   ܄$8@ B0!CB !CEB0-@$ ԁ bĄ BB0h@$ԁ B0!CB !CE S bBB0@$  @ԁ B0!CB !CE$ ԁ bĄ &B؀$!@ ԁ   ܄$38%@ $4BB0 IB$!@ \ B0!CB !CEB0@$ 6<BB0@$ @<ԁ B0!CB !CE$ < Pԁ B0!CB !CB,B4ԁX$0$0f!Dc0c8B !DQ%0,XԁXc0B0b`!($BB0@$  @ԁ!($ HԁĄ ԁB<CQ`!!0` E$$0Cb!EB$BD&*@c$< BB0 @  ܄$Tԁ   ܄$B84@ B0!CB !CD! $x dԁ<@!( B0!CB !CB4D! !(|  &B0 @!  ܄$!( 0#@0~ԁ   ܄$8@XB0 @  ܄$$ $ $ B0!CB  $!CE!8  B B0@ D$l[9' #W $b/$B4ԁ   ܄$n8`@XB0 @ $  ܄$X$,: B0!CB !CD+8 WB B0@ D$l[9'  bԁ   ܄$8@ B0!CB !CB4BD D $) ԁ  BB0@^ B cB0c0 " #ԁ   ܄$8@XB0 @  ܄$ &1 @$  ܄$!(5 b0㌀!CB ㌀!CB!0 B0~ԁ   ܄$p8b@ BB0 @  ܄$Y B0㌀!CB ㌀!CB$!(!0 q xԁ   ܄$&8@ BB0 @  ܄$ B0㌀!CB ㌀!CB$ BB0 @  ܄$ԁ   ܄$8@ B0㌀!CB ㌀!CB{$ BB0 @!  ܄$!(ԁ!0  BB0 @$  ܄$!(!0!8ԁ   ܄$y8k@ B0!CB !CD! ԁ   ܄$L8>@ B0!CB !CD! ԁ   ܄$8@ B0!CB !CD! Dԁ   ܄$8@XB0 @ $  ܄$$c: B0!CB !CD+8 WB B0@ D$l[9' W<b b<b BB0@$  ܄$ BB0 @  ܄$ԁ   ܄$y8k@ B0㌀!CB ㌀!CB$  $0@0~ԁ   ܄$?81@$ B0!CB !CD:+8B108 cWB B0@$ԁ B0!CB !CD!0p  bԁ   ܄$8@XB0 @  ܄$ !( $  $-I $ B0!CB  $!CE!8 B B0@ԁB<B B$*b@b$ $$bbB4bԁ   ܄$8@XB0 @ $  ܄$w!0: B0!CB !CD+8 WB B01@$$ԁ B0!CB !CD!0ԁ B0!CB !CD!0p  b bW<b b $hI aԁ   ܄$8@  ܄$B!@ 7 B0!CB !CD ԁ B0!CB !CBBB0@d$ c!@!CbT!1&+d!0  @!QBT@B$"'@܀ !C`;$b#$b! `<40,($ !@'<莜'!'! $!($ (9' $옥$ ! @:$b$Ѐ $!de`"#$`R$|c@!CB B0@$@@'$p ;$$B @$!@$!0@ @! @$$ !@  ! $ !@$0! !($ !( 0'b1&R ! @(k9' !@H1& $ $ $ (k9' !@31& ! @-$) ! @(k9'  S1&!~!^cB%bX $h s! @..!0!8(g9'  ! @ B$$C  B! @!(!0̆ HD<840,($ P'<8)'!'L!!8!$H!@D!@<!@XTP@40hE^ԃ h-!@ B0(@! ؆  @!4؆ S, `! 4܆  !@4 !@h$ B4  '(!$\ !@$2|c@!CB B0@"*(!P1&"*@'$" % !!h!HcQ@%b $ !  $!0`!8(g9' h! $$! ..!0`!8(g9' "=$fb %!HT"2@%C $ ! ..!0`!8(g9' h! $$! ..!0`!8(g9' #=$2b %!HC2@%C $ ! ..!0`!8(g9' h! $$! ..!0`!8(g9' D! $$C XTLHD@<840`'<$'!`$C$B0!$$. \ !@$"$&.|@$H!$!""!\@>7! k$XA@' $'(<}9' \$'(<}9' S$ 7$<$'(<}9' E!!` 6b&@! `',9' 6!*B@Q0R&.$-6$+! >! '$({9' $&䆙 !! '(<}9' '$({9' $$p$ $ ' '  ' '<'!'0膒RL!D!<!@!PH84,_@(D/$ !0@ *$Àb!€T,B #D$ !@!:0@!@3<B0@ !<B08!"1! E!0` @!3B@ D! $ @!,R@!J0@!@Cd1&<B0@  '<B08!8 '$!0 p !  '솙 @4  !  '!0@1$< @ '!D ,_!@0@!@9<$B00Cl$ @*@! $t$ @*@!$$ @*@!$,!0@!@! ,X9' @!,! * B0@! BB0@!(!0p #0FX ! !(,t9'  B0 @$ PLD@<840,(X'< '!0'!! <#!@c0b$B,@$"bą ! @ 'ȅ  PC!(@􆙏 0b0B?@!0@ b0 @b0 @!BB0@$@4c4c4nj!0@   $ 0D!(,t9' <"C0b$B,@'$b '<'!' !($<B0@  '<B08!8 '$d$p !  '솙  @!  '!01$< B<C0$b$b$8$+b$Р$ +@$ؠ$  @$0!! ,X9' @$,!  ! b! L !@`$!( 0'<'! '!<bC0b$B,@!$8b$ą ! @('ȅ  XCe䠄$ԃ $e!@ !($XG, 0b0P$& "B0@! $!0@   @ @@% $   % %$  '$ <B0@ <B08!0ƌ<! B0܃!bc '!( BB0@ $$!0p $%#0FX ,! % $!  @! ,X9'  @!  H$  ! d$ ! !( ,t9' % $ ,AR&<bC0b$B,@'$b '<'!' H !< !T P L D @ 8 4  ) '!(lc$c$, (   0 4 <B0@(' $<B08!8$d$p  ! ('!(@, 1$<   ! @$(  ( '!0`, ( D$@  ( '  , E(('! $Ѐ  ! !(`!0@!8$' \  #c0`!@! p$!0  $!(  ! `$L  !@ @!(@$  , '$X  ! `! @  ! !(0 '4 '܁  &!@  ! @@  ! @  ! @ą  ! !(0 '4 '$ȁ  !@"K@('0 $䁙  @('$%  %('  ('4 $䁙  V@ "B0 @! $('  $%  %('  ('4 $䁙  0@0 %P  ('4 $䁙  @ "B0 @! $('  %('  4 %P  0  4  ! ́  ! @  ( 'x  "B0@, 'd  , 'D  T L H D @ < 8 X '`! *6@ B0r@0#<bB0@f 0"<BB08!0ƌ0"! G$  c0'c09`!0@8$ B0=@0#<bB0@f 0"<BB08!0ƌ0"! G$  c0'c0`!0@$$ H@<840P'$#;b"#1^Z$1&#"b.I.H..+@g+$-$B?B0! 0$=0@D0 &@D &@&"&&1&1&&&4 @<$@ ( [$bD$ b($d&$ E' b<$d&$ ;'b!   '$ +'ed B0#b@!bB&?0#D!b#B0#b@!bB&?0#D!b!  ' '! $!0!8@( 4 @$<$@  '$$!8p ! !( '!8p d$( C1&'4b! F$t  '$$!8p !  '$$!8p 4d'!($!8,9' }!  '$$!8p 4b(G3! @$/!(8@ '$$$!8p !  g!( b8@!(4d'!($$,9'  '$$!8p 5! 4b!0D!8,9' 7@!(4b!0 D!8,9' @ '$$$!8p ! 8G!(! $!0Ѐ ! @ '$$!8p 4bD, ! !( '!8@p 8@ '$$$!8p ! 0g!(0b@88.@!('!($4d$,9' BB0@ '! H$ !@ '$$!8p ! 4bD!0,9' @!(4b D!0,9' @8 '$$$!8p '$$!8p 8"@bB0@g,@!  ! !('L$p QOusbB0m@bB,@@>8 '$$!8p B1,@B1'@! 4b B4b B@',B$! $Tg$p ! !( '!8p Tg!(4b G! ,$!(cB0#@D$B0@d$BB0@*$B0@!$BB0@r$B0@@TC(bb-$bBB0@N$O$$'4b!0D$,9' 7@ '$4b!0 D$,9' '@ '4bD , ! $$ D, ! $ $!8@p  '$$!8p `!  '$P$!8p DB@! `,9' D!@ + @! DB!PG!( $! !( 'p @4bE'! $Ѐ ! H$ !@ ' '$$!8p !  '$$!8p 4bD4  @4bD  D4bD, '$ '!8@p '! X$ !@! !( '!8 p cb0@ $ P$b0@b0S$@ 'K$ '$$!8p -bB0@bB, @! @!(`$ $4CbB0@bB, @! @!(`$ $CdB0 @ @TC(bbBB0@ $ r$bBB0@N$O$o$n$cBB0(@B0&@!$DB@! `,9' D!@ + @ $DB!PC $*$dB0@'B0@d$D$! $\$!8@p ! !( ''p ! !(d$(!8 p 8@! B1@0!(, $| pld`\XTPLHx'<|Ĝ'!'@ D ',(, $$| ,0'<Ĝ'! '!!!!!'t '$L !@D !! 4!0$H  $!(  ! `Ħ&!( !@ ! ! ` !( P !  !  ''!( H $ C! @' 'X '!( H X ! `'x x 4'8$܀ '!( !@! `$L !@! !($L !@! @$$!8P  @! @$!0@!8 T ! @!  !  'x 44B4b44&4@X 4d 4b4D 4b4 D 4 b4D 4b4D 4b4D 4b48R@Ȧ$E $ @$!9$ئ$E .@BC`P$|c@!CB B0@&@@! !(Ѐ ! !@d !঄$E$ @$BC~`P$|c@!CB B0@&@i@! 覥$ !@ '!(!0 $\ "@'|c"@!CB B0@'1&" @$!($Ѐ '$ ' !@!   8,b@,c,b@,p'd 즄$B'!@ !$E @!(D!$` $B0$ % !@RB4B8bR'@܀ @ 44$܀ '<'!'!! $ Lb @f$ŒP!` c$b@ $H !@`!b @!d$P!` c$b@ $! ('<蹜'!H'!!!! !(  '$!0@$ @$!(  '$!0@$ @! !(`$ 'p  '<и'!'<!(!8!D@40,$ )@! $!3&! B.#@!5! &&R&! &1&bs&!(@!8,(9' !  !#`#B!D<840,($ H'<'!' !$!0,(b!Po!2|B@!bb@B0P@ B B0@ *,F@ *@"*$"*??$@ $;!1& *@ $#^$+!(@ $$%^$\$!(@ $e$\$!(@ n$\$!(@ r$\$!(@  t$!(@ @&P0 ! !(@ cb$bp1&!2#0($ 8'<|'!'(! !$!*0 @, $!(@ &'$$#80p ! @'$ ! 0($ 8'<'!'$!0! !! @!(`84,(L c(q(  $!!(`  $Tb(@ $b$c2b(@$b$C! @ ! `!(@!0,9' !@>! `삄$  @!(`$ $!(`  R&! `#($L',h9' L!B #+b`! `B$L! `#($L',h9'  !B $!(`  ! `!(@!0,9' !@ ! `$P',h9'  $!(`  $P{@ $B6#R@|@!EB B0@!$Pc`! @P c!@#r*q@! `!` ! P!pBU&!p! `!! `!( P',h9' PB2@ $삄$  @ $!(`  !Bc#B@c0`!"1&! `!( !0,9' P`!@ $!(` 80,($ @'$$!<'!H'!!!!'!(@$Ѐ '>@<`<$@#)b! >$ !@ &!  L$̂ !@$b! ! C,9' !@`b$!BB@"1&BR&"@s&#'<('!'H!8!4!D!<!'0h$PL@,X9' !@! ',9' ! !@ 2 "!  "d!""!K@(*t@(*b'@@( ($ ($ (' (*@4! !CBb*b s&@!*s@!`!`((@*t("3d!"1PHD@<840X'<'!'!8$ ,9' $('$dbr&+Va@B<$G+VR&+V@W@! @,9' !@ $&D!(!#r`T$!! @!0 @&@1&!Wb@!(d/S&@!'$,%9'  @! @E&&,9' !@! &@1& ! !(  S&ds&!( +v@@<40,($ H'<'!'!!$$. $#$"$! !(  @B$!P!( 1& &$,X 9'  $! !$('<'!'0!(d!BR,!4!`<8$ @ !(`!0`!8`,X9' &B,@$ <c`@#C!C(4 ' &B, @$ $8b#~@! ,%9'  @!! @,9' !@ $$ $,9' -@( $,9' !@ !( ! ,9' <$!( + c$b#@!!D,%9'  @! @,9' !@ >$& B$!PB c$@!O &@ B*S@B@E8! !@B8c!B*C@@E8!EB ! !0`,X9' -Bs&b& CO$%b!`& $!D,9' d!BR& BƄ$!@ $<40,($ @'<ԉ'!',($ @!!&&$ !(`F,h9'  & R&@ 1&,$ 0'<('!' ! L$($l p@&B,/@2|c@!CBB0&@&*&* @^$ $c$b@&B0bO` $$ $$9B02p ;&,@2 $$ƥ$0 *|B@!bb@B0 @ B B0 @, @ $$$  $ $$ $$2p  $B$( 0'<'!'!!$! !,`(&!@c@!CDR&,9' ! !(@!0 Ѐ ! !@ !@b*B@## !$,$ 0'<'! d!dc ` bEc`!`<ą'!'d!(,$@<840,($   $$,<9'  T$$,<9'  $$,<9'  H$$,<9'  `$$,<9'  0$$,<9'  $ $,<9'  $ $,<9'  $$,<9' R&! @$;$,h9' s&! `$:$,h9' DŽ$$2$,h9' DŽ$$9$,h9'  DŽ$$3$,h9' (DŽ$$8$,h9' 0DŽ$$1$,h9' <DŽ$$1$,h9' HDŽ$$1$,h9'  $$,<9'  DŽ$$D$,h9' (DŽ$$M$,h9' Lǵ&! $m$,h9' X&! $v$,h9' DŽ$$m$,h9' DŽ$$v$,h9' ! @$t$,h9' ! `$k$,h9' dDŽ$$L$,h9' hDŽ$$L$,h9' lDŽ$$L$,h9' pDŽ$$L$,h9' tDŽ$$L$,h9' xDŽ$$L$,h9' |ǔ&! $L$,h9' &! $L$,h9' '! $L$,h9' 1&! $G$,h9' $$/$,h9' ! @$`$,h9' ! `$\$,h9' \„$$k$,h9' X„$$t$,h9' &! $B$,h9' ! $/$,h9' ! $o$,h9' $$o$,h9' 0DŽ$$u$,h9' ! $m$,h9' ! $v$,h9' ! @$`$,h9' DŽ$$\$,h9' ! `$\$,h9' DŽ$$`$,h9'  DŽ$$r$,h9' (DŽ$$n$,h9' dDŽ$$L$,h9' hDŽ$$L$,h9' lDŽ$$L$,h9' pDŽ$$L$,h9' tDŽ$$L$,h9' xDŽ$$L$,h9' ! $L$,h9' ! $L$,h9' ! $L$,h9' ! $l$,h9' DŽ$!($,h9' ! !($,h9' ! $$,h9' ! $$,h9' $$$,h9' @<40,($ H'?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~|ք$֥$ ք$ ք$ ք$ ք$ 8ׄ$ Hׄ$ dׄ$tץ$ ׄ$ץ$ ׄ$ץ$ ׄ$ץ$ ׄ$ץ$ ׄ$ &!( ؄$!( 0؄$!(  $ ! ` ! ` B@!(! d!0p  &d\  $H! BB$ B!@&d!(!0p ! `臙 4BB@ @! '쀙 4Cb4D @!Ā 4Cb&d=!8b c!CB8BB!Ad 8c d!dc8d#CB$8b c!CB8CbA`8b c!CC b@!& b `!''!'!!$9  :!#5b!#0b!8"8Db)! # $b!<4#$d$Db!4$4,U9' @!8$8,BB05@|$0BB0'@-$"BB0@|$ $ >$*$&$̅ &B$ B,@ B R̅ &k@( 0'<'!BB0@!$B$#C+e@!!(`!@<'!' !!($1&,("!0$  $B01@c"b B0@! BD$!($$ cBb B$B$   cBB0c$ Ԅ $,$ 0'<'!' ! '$($,$p cBbB B0@! BD$!($$ ' cBb$$C( 0'<'!'!0,($ 80 "!* @$ s& t&"*@'$!0 ("!8!@ '$,0x9' BB0k@! 4"!@ !08%"#(!($ (  "$$8ܥ$ B$t 4"! !@  $̅  8%"#(!($ 4"! !@ ! @'$,u9' cBvb "db$r'$ B4$R% b B4 4"!@ cb!08%"#(!($ ( 4"! !@ ! @ &'&0+0,u9' $r'$ B4$R%  B4!08%"#(!($ ( 8" #&!C*@ 0($ 8'< '!'!!0($ <8!(#($ 1&$$"$r'$ B4$R% " B4BB0@<4!@ <ܥ$$t B0B@!0( '$<(!0!@ '$,0x9' $<8!(#($ <4!@ ! @'$,u9' c"b!0 8!(#($ 8ܥ$"$t c"b<4!@ ( '$<(!0!@ '$,0x9' <4!@ ! @'$,u9' '$ (!0!@ '$,0x9' %"$r'$( B4$R%("!0 B4 8#(!($ (  4!@ ! @'!0,u9' $"$r'$ B4$R% " B4B0( 0'<'!' !!0($ EB8C!(#($ '$(B G!0@!@ '$,0x9' BB0Q@$ D4B!@ !@( 8ܥ$ 1&"$t  $̅ '$,0x9'  D4B!@ ! @'$,u9' c "?b &$q'$( B4$Q%( B4(  D4B!@ ! @'!0,u9'   $q'$ B4$Q%   B4BB0B( 0'<'! *C@8 @ B$8Cc4CC8 !8*g@*fBB0@#eB$#fE $<A ! 8"@BB0@b$8#E $<A #A88B4<('!X'!4@!(8 @܄$'$!8耙 '@#@'< C$ `*b@$ BL܄$Bd܄$!@ '< '!'@B$8*b @b$ 8*@$ $Bp܄$Bd܄$!@  '<4 '!'8 @B$ 8!C*@$$ $ B܄$!@  '< '!' 8 !C*e @ *C@8 $ $C$ B܄$Bd܄$!@  '< '!'!(8` #bA888 ! *D@$$ $ @$ B܄$!@  '< '! 8C$ < '!'8 !CB$$ *b@$ Bd܄$!@  '<, '!'$8 !*@#f!#f!CC! $ Bd܄$!@  '<'!'@$ Bd܄$!@  '<'!'@B$ $ Bd܄$!@  '<'!'!(8 !CC#A888 ! *D@$$ $ @$ B܄$!@  '<'!'"8 !*E @!bC !*b`8 $ $C$ B݄$Bd܄$!@  '<'!'@$  8Bd܄$!@  '@!@!QC$!u!UB4!U! !(&&0`9' @$Cb$b $b@@ & $@ $b&s&1&*>@R&! !(&0`9' @!(@!T!U$$& ' r@@!($(' ;@(_@!(!Q$@ ' @@@!T!U@@! `!8t $!(#004 9' @!T!U$!T!U$C(!/Q@@!T!U@@! `!8t $!(#004 9' @!T!U$!T!U $C C,Bb@!T!U$C@!T! U$b$ub!‚o@! !!RW@!+! @!($ ' F@$ @bbB$bb( @ d&@(!((@ b$Q$ !0t$!(T @!Q c! C*@$*F@!@!q b,D!bD b !bD b$!bd$!$0R@+&@!Q c!CT!B@!XTLHD@<840`'<~'!'0XP!,! !(84$ŽTJ@!!t@B!(@!0p ! e&!0 䁙 @! 5$ !#R $!$"$®e$_$+@d0F c$@c$c$bc$&e $B$B80,($ @'<|'!'!$!!40,( E|c@!CB ! !E|c@!CBB0@R&R&;$R&R&`!Cm$b!@*2@;$$!$1$b4$"&RT4$&b1&B4b b"&RT&b1&B4ub5$b7$"&RT7$&b1&B4db b"&RT&b1&B4Vb0$b3$"&RT3$ bUde &1&$b: ub|c@!CBB0 @b1& B4b&B$$b4$b*2|c@!CBB0@*2b1& B4b&B$ bT&1&*2@&1&*2k@!@4,($ 8'&$b! @D&*h@!`&!Qd&$b`[$b$2('&!00,9'  T$F!$2 $ @$$bcP$*@`!6!|B!bb@B0 @ $ B B0@%2,@ $!|B@!bbB0@@,@ $ ^BB$*b @s&s&&B*b@BB08@B$b$ B('!C $b $b $b $b@!! $ $! @!rBFEDR&@!rT&('!T "1 @ $b&& $b&& $b $&b('&D#0*@@ !I!DB@!( 09'  @!H(! ('#!b"1@!1E@! @ F@@!F! C $b!(` E 4$$p$P'$%C(  $ČŒ$p'$ B4$P% Œ B4 (  B@B0 @!@ !I!CS!A!@('('J1L!!Q!VC$-b!0!8@DD&*'@!E0 q_ $_$h `!0`Ԉl# D@!^l!DBc$*C@ s&@!S!dB $J$p!0@b$!D*e@c$bFs&*e`$l!0`!`!0`l' ! $C Bd$!@ 0$@!^l!EBc$*C@!0' ! DC w@$ $$Bp&/-Bp&pp&*P@!0`l@!P C$!(dC$!dB4! D@ $ Ib@@$c$&*@$p*+@3!'@l!P C$!(dC$!dB4! D @  $ Jb@@$c$&$ !B$!@ 0@!Sl!C BJ@$ $G$B$B $$ $ $&!($ $耙 0(@$$@$$@H' 0p@!!l! "@$ 0&lp!#1& $*@ i $&! Ђ 0!(F4 08@! @8'$ 0$B8'!@ 0 0t@!!l! "@$ 0&lt!#1& $*@ j $! B1Q4h'l' !8$(09' 0@&- !`p*K@!0`l@!P C$!(dC$!dB4! D@ $ Ib@@$c$&*@$p*'@@$!"@l!P C$!(dC$!dB4! D@ $ Ib@@$c$&$@!@!Sl!C B@ $B$!@ 0J@$G' $J9@$ B$B@$ $ !$)D 0 $ !$ $B$!@ 0$ $J9@@!Sl!EB $I@$! !0`!8@@$@$!!`@!Sp*@h'l'!8 $$(09' 0!@ `l!"B $I1&& a@B$!@ 0$!Pp*@h'l'!8 $$(09' 0!@ `l!"B $J1&& aB$!@ 0i$f!@!^l!CBc$*C)@!h'l' !8$(09' 0@&lp019' 03!@BH$!@ 0($$| 0 $$ 0$Ď BB0 @' 0 $x 0$Ž@!(4D| 0ŎԁXB0 @ $ 0 $$!P 0c$ c0`$\ $ĎԁBXBB0 @ $ 0 $$,G:+8 0$C$B B0@Z $,$B[ $By@ $$[ŽW@4BD 0k$$&"1T0@u0 0 b0@c03Ž/@ b4B "@' 0c$bB0Tb@B0U"1@$} $&! `!@lC$b@R&&*p@c$t(@!!l $!" D$ $!P @I@@ J@@ 0 l! "@$ 0t&*@1&@H' 0!0@ph'l'!` $!(!0  !8`$(09' 0 @l!B@R&@&s&! $0@ $0c0Ŏ|ԁXB0 @$ 0 $p $908 0WŽ@ŽO@Ǝ !( Ď!8 0 Ď 06Ď2 0I$)Ž%@ BB0 @! 0 $!(!0!8 0! $Î` BB0@$ 0 $Î` BB0 @$ 0 $!(ǎ!0 0 $Î` BB0@$ 0 $Î` BB0 @$ 0 $!(ǎ!0 0 $Î` BB0n@$ 0 $~rƎ !( Ďǎ 0$cŽ_@$B!($B)$BF&$F&,`G&,Ď'l 0@$B)$B$BB B0@\ $$B4 $b0K@$b0 $E 0 $b08@$b0 $2Ŏ$ԁ $B90a8ŎԁXB0 @ 0 $B0@ $$ @ $!8  0ԁc$Tbc$ c0`$\ $ŎԁXB0 @ $ 0 $!8 $ 0c$ c0`$k $ĎԁBXBB0 @ $ 0 $!0G:+8 0$C$B B0@Z $,$B[ $$BQ@ $$s 0m$MĎI 0ŽBB0U@<ԁBXC%dLXC 0J$*Î&` BB0 @$ 0 $!(ǎ!0 0 $$Ď 0 $B!@ 0 $ 0 $$$B!  0 x'Ž@$ԁcTbx'0h 9' 0t @!!l! $ 0 l! "@$ 0t&*@1&@H' 0l' 0@' 0$"!! !`'<4'!' !(!!!$ $, $40<! !0@#(䁙 @<B|c@!CB B0 @!  <@<T B$! $b5&&|c@!CB B0@! @\ &  !(@䆙 <'! @\ &!(@䆙 &&<#"&+@! <'$@ <!Q4,($ 8'<1'!'!! <$($! $ !@! R$ ! !@ !"!( 0'<0'!'!$!($  @!(B$$$ @!(5$$$ @!(($$$ @!($$$ @!($ $ !@`$!$ ('$ @#R!&& !@! !(@!0 !0! ( 0'<'!' !($8<C0$b$(b0$@(` @D80w9' 8 '$B0$e%b ( 0'<'!'P!D!$<$\!`XTLH@<8 !$!@ ($ &` 8b#@!  8$8b<C$$ec4<C 8cb8d<$$CB4<8c$b!  !@R$! ( '0d9' ! @(@!T$ ! @,:$/bX$($T @('($쁙 !@! `b@!  #b!(!0p (',C$,B@! |,b@!DB B0@b$,b@,B@(Bc!CBC$b,9@X!$!""!\@(`$$ @(p$%$($$ @D,$쀙 B($$  @$ D,$쀙  B$($ @($$ @`$,8e0m9' ($$ @`$,0 g9' $8eB0<$ % <($$  @`$,< 8cb($$ (@`$8d $ , 8c b8b D 8c dF$!(, c($$ W@T`$,8e0|q9' J($$ >@0D& , /`0B,!(`4p9' $b($$ @`,!(4p9' ! !@ *bB4b($$ @D,$쀙 B($$ @` ',$Ѐ  '!($, ($$ @`$,<  b($$ @`$bB4b($$ @$(D& ,$4|9' (B$($ u@($$ @D&Ȁ ?($$ V@D,$쀙 LB($$ @4D&܀ ,$0Pf9' 04B($$  @D,$쀙 B($$  @D,$쀙 B($$ @`b@,;$ @D$!(4p9' b($$  @ B@$,  B($$$  @D,$쀙 B(,$$ 3@`,b@O$r$$cwSb(@feb  B4B0@bB4bB4b,C$,B@r$(4$$  @(@$$ Z@X`, P,B(L$$ D@D,$쀙 :B(P$$ .@+`,b%@D$A$F$cfEb(@e d b B4b@B4bB4b,C$,B@$' &@!  $$ $ 8B!@( (!b:$b( !  !@(' `! 8cbb 8cb *@ '4|9' !@,4D !(@ @,'$$ ,C4CC4B D䈙 D䈙  D䈙 D䈙 D䈙 D䈙 D䈙  D$  DF$!(, ,$ E0' @ B4!C B$Bb@!@bb!@`\TPLHD@<8h'$ b'$ $!0$ B$!0 c!CCK$b$M$b$"C>$Yb-$b! Q$$"B$"|c@!CBB0 @'!0 ! @ c!CCK$bM$b $@ B$$ @|@!EB B0@!$c`! @!#0($ 8'<'!',!(!0!! 84$ '$ ! `'!( !0!@  BB$B,@/$$!8`b!( !B$!0 B$B B,@$p !S!( !C$!0 !@Fb(@Cdb$mb(@b$B80,($ @'<'!' !! '!0($ ! @cm$bnb(@d$b! w$ by$b#D#D  #D#b  #D ! 숙 ( B$0'<'!P'!!!'!($ '!(0$ @@('DF$Ѐ CD$!d`! !(,$ X'! `!(,$$4F$< $l $h$d$`;$\Xe0$ m@! '$ !0@C<$b!! ! C$GHI J B$C$GHI('! `! C$GHI J B$C$GHIC=$bX'&$¬;$X¬! $489' _('X'x'GHI Jghi jB$Dc$GHIghi,(H0-$P!( !0@4P9' ! @)-P$.@|c@!CB B0@$@@X'!0@4P9' @('' $<84lhd('$Ȇ X'$Ȇ ' !'<'! c$b @&bD!`c$b@!<'!@$($)$G$F$$@!<4'!' !($.@bd $ @$4ܮ9' ' @( 0'<<'!'0!T!D!4!@! <! '!( $XPLH8( !  !  b@$|b@!DB B0@b$b@^$b_b(@!$b($b$|$ b~$*b$s.$.!(@B@$$ !@!($"(#$!!!B$$$ !@!!($"(#$$ !@! !0(b$d4 9' ! @!@$@b$b@|b@!EB B0@b$b@ S`$B@! '!0!` $C('B4p9' !@C)$b!(@$ ! @!(!0,4ԯ9' !@,'  0(!4!3!B&4$p p('B@(@$Ѐ !!de`B`@$$ S!@R$4$p K!GL$p .('G`$p  ('$p ('$p (' ('4ܮ9' !$(((XTLHD@<840`'<|'!'!! !$!,(! !( !0@!8`489' @!! $,$ 0'<'!'!! !$!,(! !( !0@!8`489' @$! !,$ 0'<4'!'4!8!0!(!,X'T@<$4@ b&$$CS$p) @!! !0 !8  @ @! !0!8 @$ . R&@b&!@840,($ H'<ޜ'!'$! !,(! !0!8 @$! !,$ 0'<`ޜ'!' !!!( $! 䀙 B !  !@! 䀙 BB. 1 ! !@( 0'<ݜ'!' !!!( $! 4 B !  !@! 4 BB. 1 ! !@( 0'<ܜ'!' (!40,!B$<*,@! !$!""!\@!0!8`49'  *!0!8`489'  *y&vB,b^bZbVbRB@bB0]+bB0XB,@bOB0bB0IB,b1B@bB0B8;+bB0B85B,bb(gB$*@!( $$*G@&$g!g!*@ *GC8 &('(c$49'  04bB$4ܷ9'  04bB$4ܷ9'  04bB$4ܷ9'  04b B$4ܷ9'  4g @! !0`4g( @!!0`(!8`  C,&#0g*@! $*@&$&8bC*b@!( $*@&$&4b4E4(9'  I4cbbb0 b$4ܷ9'  14cb0 b$4ܷ9'  4bE F49'  4bE F4bE!04t9'  (&bbB0@!(bB,E8&bB0&bbB0&bbB0 &bB$!@  $4,(8'<֜'!"$€Ð@$$\ $" $$+@IJ$%$%€Ð@$!"$C!@$''/b,B@!$!""!\@B66"/I'1&"$(@(F>$+h!@1&d"$@c$E+h"I'1&"$@F>$+g @1&d"$@c$E+g"F `B$!@ 3!1&"#@b$@@x ' x"@!@! ' "!( 0'<<'!',!0!84((E` @ $DE!0p  !( D$L 8$&4" 8E<C0$b$\b ' D 8B0B8"8B0PG   '$Ѐ <$$C< '$ !(  'D!8 $>C &  ' <!  c4<T 0& ,8Bm0@t 8E  'D!8 $C '4$&X  '4$&X 8$&  ' E$ D$8" 8$ $8$8B<<B$eB0%b<8BD 8#b8BD 8#b8$<$$C<8#<bB4<b ' !80,(@'<'! %c$EFG Hefg h b@b@b %B$<'!'!80!(!$'ƌ$<84, x '!(@'!8@܁ !@!@ '$ '$s&䁙 '$䁙 v@@$$ &!$ &!$ !@ !@$  "!@'!(` !@'!   &c$c*b` &!$"$!(쀙 ! !(`" !@'!   &c$c*b`!  &!$" "! !(` !@'!  " ! ́  @!@B'!@  !@!@' !@<40,($ @'<쬜'!'0$ ! !0Œ!0E!8 $('<'!0'0!!9'!(Ќ$B$B!8 0 &B$B &c$c!CGB("@ &c$c@!CAB$ &c$c  &!$$@!CAB$ &!$"!GB(@!P8'F$t 0@ $*$! @ &B$B#&B$ &B$BcB$ $8'(!(`B$,p 0'<|'!(!(B,4@<B0!@`! B B0 @!( ! !(49' !( !0!8`49' 0 @! !( 0!0@4d9' @,80,($ @' @840,($ H'$!b$Ž@$ !$"!$PHD@<840X'9' ! @] `( b(H(!,$ ,b$B,@!# $b,B$,!  ','$489' ! @=!@|c@!CB B0@&@@,*@H' ' ' '!@$$'$!@4@9' +H'4d69' ('H'4d69' !$` @B @ '!@  bH@840H'$"1&&B @ :$"&1& $;$"1& ( 0'8D, @ 8b$􈅏$C$$C `! "2@$4b(F!0$ ' @$  "24Cb!@ b@b@ "2 @B$!@  '8$ "24B B!@ "2@ $X$肙 @ $p $hC 'Bt$!@ \ '8D, @ 8bB00@'8!(@ $ P P"280C `'80@ @! @  '"2 @$$􀙏 $C ' B@B0 @@"2 @$ 4D 8D8x9'  '! $  @!($ @!BB08rm@!`<BP0$gD$ @8BD$ F@<ŒB0FP$B0C80B0C,S,v0Œ8 $C!)8RbB0@0$ 80C88x9'  8b8C0c8C8 @ '!0!8 !`8R0D,$ '0@ 8b0B,S8b0B0B,VBB0 @' ' 8ا9' !@$ "2 @8D 8b$ V"2 B@B0@"2@"2@"2$$ "2<@"2 $! $!8@ -"2"2,@(@$@"2<@!$0!CB !(CBBB0 @! $$ <&*@"2@ x x7  >!  ' '<՜'!h'!!h!=$x'l!p'|t\ !@$b$'l$!0@T @$'t$M$Ѐ d&&$$L$.$bL$'|$M$Ѐ d&&$L$9 $7bIW! !(I $!(  'b$B'U!(W  $!( '!$ $Ab $? $* $Sb $$bJ* @! @$0 ! ! !(W ! $f2   $ ! !(  $!( !2&I!)bb&_B,@J*$w@! ! !(7  $!( !'!! $f20 1&R&&31&R&&@&'!8" $b $/b!0J* @! 0$$0 "'!! !(=$!0@  $!( ! $20 '@'!( |xtplh'<Ϝ'!' $&B$B !($@ &&B$BHB( @ $!(@  &&!$ $&B$B!@B(@ &$!D@b$!@B(@ &1&" X$! !(@ !(@"#B0%C &&c$c X$! c$ &&!$#  &&B$BB$ &&!$" $&B$B X&B(7@!(@"#B0%C!PD  &&B$B $&c$cB$c( &&!$"`!(@"?B0!PD!(@  &&B$BB$ &&!$" &&B$BB0@=$ $&!$ ( 0'<̜'!'!! $&c$c$ b8@9'  $&B$B C$ &!$!"0 $&!$#('<̜'!'0! !4!$,! ( $$ $<8 &&!$ $&!$ ! \ !@! @& & 3 $!(@8H9' &&!(@8H9' !8@9'  $!(@ <40,($ @'<ʜ'!'(!40,$ <B0@! ! <B08!0ƌ! $ u@ $ j S$"b@;$!( '$&X$< $$܈ @'%  @'$'$p ' $!@ !P&!pB$MB( @ $$!(   S&!( b&!P! $&' 1  $!(  ! $ <BB0O@B0$ C @$C@$<$B0C! $$ $!  ! /$ @B$!'$!0@X$< ! $'  $!( <C0$b! ܃!0ƌ $ ! L @!$4,($ !`8'<Ŝ'!P'!<C0$Zb!$ԃ  @'B@$!@ $!(@$Ѐ 0,$! @t$' ! !(@8`9' Q $!(@ ! !(@89' Q$,! @! @|$' n! @$b$  @!(@$ _! $ !@  B$!@ F$<C0$b$0 ! !(@!0@89' ! b!(@0 ! !(@!0@89' ! ! P !  ! @L @!$!`'<`œ'!'<!0'4!8 XR&D@( ?B0!RB1&"*@&$'!0`؃ D<840H'<'!'(! !$!$@<840, !@!!B44܆ @!V$$ !@ $ $! \ ! @$1&@B4`B4 *Q@! !@n!@ $-0! \ ! @$ !(B4䆙 ! @B4`B4 *Q@! !@?!@@ $B$8 $ (/R&@$$B$("F8T,.8S,$"$r$$"$o$$"$m$ $"!B4!R&B$ !VB$$C@"*B4"*@!a $`! ^!!  !@<40,($ H'<ؽ'!'<!4!0!@8,($ H!  !@!$*@$!!x'$$$p '$''$$Ѐ '$ !@'$!0䁙 @'#$ !@@'|cB@!CB B0@! @R&B@! @$ !@'&@! |c@!CB B0@! &@! $ !@!  !@*;@*q9@! # !( 0@q#q!^C.$b!! @/$ !@'H&$ @|c@!CB B0@&! @胙 !@! !!  &*@$!@<40,($ H'<'!'!4 $  @@B$#4܆  @B @B0 @@4BB$ ('<'!0'! D!`!`; '$ !@  ' E8$B$$!@  D@H $C@$ !  PB 't  'H$L !@ ! L$ J'E!0p ! !(@􆙏 ! @!( 0D89' ! $FG!(!8 T$!( 0D!(8`9'  $!( 0D!(89' '  `!  @!  $<C D$bB4<B $DB0@  ' ! @<B ' DB4<BH $ C0D&@$  PB 4B8@'&@'|c@!CB B0@'&@$'$p ' ! B$#(!0p !  ! @ "1 ( 0'<'!'d! %@$!b@!BB0@! .$ !@ & ! .$ @!d! ('<@'!0'0! 0'$ 0! !@89' 0!@ ,1 1& 0c$ 8'$ c$cl$(, $$p 0Z$ B$B $C$A$8' !$" 0'<'!$" ~$B"! 8L 9' ! 8L 9' !0@$$B!( !@ $('H @$'X@!0 $$!8؁ $'$ $' ' ' '  ~$"$$! '<|'!'!$ ( ! !@ ('!E$@ (!( ! ($('<ȇ'!'! @!|B@!bbB0@.@$. @&$&@! ('<'!'(!40,$ S$! ` !@"$(E|B@!bbB0@.@$. @'s&!(`#0@ !P\$"1&BR&"B@1&"$" 4,($ 8'<ą'!'! 1@! -@ )@$$$ $$!C$ '$H$쉇 b< ' b!  􉙏  􉙏 􉙏 􉙏 􉙏  '$p  & '  889' ( @89' ( ('<'!8'!!(@ԁc8b*B@! b!bdBB0 @!(89' ԁc8b&*@ԁ(E` @'! `t ! `h$L !@'BB0@$!$ED!0p !(@!0D!8 舙 (ƌ! $`$ $89'  @! p$!0@  '$89' ! t$!0@ $!( ! !( $89'  $!( 8CDf!(X !  ! !(8B!0<B!8`B0B8B,8 9' ' '<'!'$!,(  8! 03 E  @'  @Ȁ  b@ p b  @@! ,$ 0'<~'!`'!!! $'聙 @!$pB$B,@x'! t ! H$L !@ '!  ''!(@$B$$Cc.%CB @x`!8#8D4E8F89' ` !0x$D  !0x$D xD$ ^`BB0Y@xE$ BB0 @E$xE BB03@S$xE xƌ€ @xD$ ƌ€ @xD$ xE $  !( 8D89' ! $$p ! \  $C!! !($p  $!(  ! @ ! L !@!  x' x' x' '􁙏 w$ x'$!0 䁙 @! & x$d!0@ x$D!0 !  xE! P !@!  @$x' xE $ x8DE89' !@x' x' '􁙏 !''!'$!!0,( p[!$44DP4"(E F@! `!(8V9' @4"$E4$D  +$r%b4"$B@!4$B@$$R%C$D&( !@b $X$<x9' $<$ <x9'  ' $4¬QQT  4B '@@<9'  6P '$<9' *<$x!$x-$h!!@\B& '$$!8p  @! @ '!0Ѐ !T@!@@840,(H'< '!'  !$ !@!B$!@ $` $ ! ('< '!'  !, !@!B$!@ $` $ ! ('< '!'!$ $30 , $4 !@! , !@B$!@ $` $ 0$('<'!'! 0  ('<'!'! !  ('$A|$VR&c+u@!!`+@#! $!0@<p9' (! <9' (!@+0 @#! `..!0 (!p!!4+@! `#!(!0  (l!q! cV+u@+!`+_@#! `..!0 (T!p$!8@0''0' ! (!@! <9' (!@!4+@! `#!(!0  (!q'!!bR&BC$@b$b,@ !$!""!\@  $ $ $ $ $BbdR&s&&BD@+2-@`'@ $2|B@!bc@b0@ B0@, @ B(@ b0@.$ $$@'<'!' !(!0,$<9' !@!0C|$$b! <9' !"@` !('!8܁ 'B<9'  L $ $B0($ 8''!'<!(!$!8!D@40, &#b0x@!$vt@0bBM@! | ! @!(@ ?@! @!($ @! | D&!(@ )@$B B0@! @!($  @D&%$ @$D!(@<T9' @$$ ! @ `"B0@"@$P1 ! !0!8@<C9' !@ c$bB4b'܀ ! D<840,($ H'<;'!0$,@X!$!""!\@HB$LB$PB$TB$B4"! ! !0 <o9' ! $B0B,@0$b$ b $ B0@! "B4"b! `!  !@! @&$ ! @ !R@@ $$ $b cbbT! @bX$S$ @! @" B4"`$ U@! "@B4P"!  PLD@<840,(X'<#'!' D$<tp9'  '@%C0p!R!0&&V!%b&PO&PQ&L@%b!P!0V@%C!R!0&7&U4!t%b&@&@& @%b!@!0@%C8p!O!0&&W!x%b&O&R&I@%b!8!0@%C<t!O!0&&Y!%b&T&xN&@%b!0@%Cx!R!0&&X!%b&x&&H@%b!08@%C&q&k!O!0&&^!%b&&&@%b!!0@%C!O!0&&V!%b&o@%b!!0v@%C !R!0&7&U!%b&x&&&&p&`&`&H(&O@%b!0@%C!R!0&&W!%b&/&*&4@%b!!07@%C!R!0&&Y!%b&@%b!!0@%C!R!0&&X!%b&&xG&h&Xj&Xs&PG&PQ&@%b!08@%C!O!0&&^!%b&p&@%b!p!0@%C!O!0&&V !%b&h&@%b!h!0@%C$!R!0&7&U!%b&@%b!`!0@%C!R!0&&W(!%b&n@%b!X!0w@%C!R!0&&Y,!%b&H2&-@%b!H!09@%C0&L!O!0&&X!%b@%b!08@%C!O!0&&^4!%b&@&@& @%b!0@%C!O!0&&V8!%b&8&8&@%b<!(@%C!O!(&7&U!/%ȣ!^!y!X!u !W '<'!' !! $($\"0&(!pF0$c(@$ !P $!P$$%b$%b%b!PC\"8B(@$(@!P`$(@c$! !(<T|9' !((@!P`$(@c$"! 8"!(<<T|9' #! @$$$#$$$$#$$$$ #$$$$#$$$\ ( 0'<'!',!!(! 40$ @! ! !! ! :$ !@@@R&&*@&@ b,@!$!""!\@! $ !@! $ @! $  @! $ @!$$ !@! !($ q!@B$b,h@!$!""!\@"B4Z""B4U"S$Q$O$! < G "! < D0 ! "< D0 #%b)#!  !"@@$$ $" #b"! P !@4! ! 4,($ 8'<'!׽' 4(!8(D(@(<(0(!Gh(!$@B$B$('$T$p  d(  0@((! @$  @('! $$('p  ('!(  ! $  @(('  ('X(!( \(!0@`(!8`ȁ  D(<(8(4(0(H('<8'!'(P!T!@!H$$\XLD4 (!@$q!c!! !(0'!8 @9' (!@ 4'! `ā (H!0'0$䁙 (@0'8'@09' (@0'&!@"8@B4!0L ( @$ (0 (! ́ (! `ā (4\TPLHD@`'< '!'!(@؟9'  '<'!'$@؟9'  'h@A\@#  P@B@|@l@\@T@L@D@<@8@0@ @@D@@@ @ @@C@C ܗ@C ԗ@&D̗@Aė@A@+D@PC@PC@PC@C @Cx@C p@)Dd@0AX@PCP@TAH@( C<@PC 4@!D,@C @PC0@}F@PC@C@*C@C@C@C @Bؖ@C Ж@AĖ@0C@F@C  >?456789:;<=  !"#$%&'()*+,-./0123@@@@@@@x@p@d@ X@ L@ D@ <@ |@P@8@@@й@Ĺ@@@d@@@@@@ظ@@@d@P@0@@@@@@@h@L@ @@@̶@@t@T@0@@@ȵ@@@`@D@ @@@@@@X@,@@@̳@@@p@D@ @ @@ز@@@|@h@X@,@@@б@@@@p@d@L@4@@@@а@@@\@<@ @@ܯ@@@@d@D@,@@@Ȯ@@@`@@@(@@@@@@l@T@0@@@@@@x@d@H@0@@ܫ@@@@t@`@<@@@ت@@@l@\@<@$@@@ȩ@@x@H@,@@@̨@@p@X@4@@@ا@ħ@@@t@\@D@$@@0@,@ @k@ @t@@@@|@@jܼ@м@̼@ļ@B@@@@m@@v@@M|@p@Dl@\@@X@L@lH@8@u4@,@J(@@I@@K @@@@@ػ@GԻ@̻@Ȼ@@@@@L@'@&p@%@$@@@@Q@@R@|@x@h@d@T@#P@D@(@@4@)0@ @*@ @T@@,@@+@@0@@F@@E@@H@@.@t@\@`@`@X@XT@H@N@@@P<@0@,@@@ @[@@Z@@x@@z@ؿ@~Կ@ȿ@Ŀ@@@@@@w@x@^t@`@_\@L@{H@<@c8@(@d$@@@@g@@@@о@i̾@@@@h@@@t@p@\@X@H@D@8@e4@(@S$@@/Ի@@f@@-@ܽ@sؽ@̽@YȽ@@a@@]@b@@p@l@`@\@L@<@@$@@@@Q@@R@T@#P@D@(@@ @*@@,@@+@@0@@F@@E@@H@@.@ļ@o`@t@\@ @k\@`@`@ @tX@H@N@H@|@@@P<@<@,@м@̼@ @[@@Z@@w@x@^t@`@_\@@z@ؿ@~Կ@L@{H@<@c8@(@d$@@@0@q,@4@)0@ @@@p@@@@@t@p@\@X@H@D@@@@-@̽@YȽ@ܽ@sؽ@@K @@m@@v@@r@@n@@@\@@X@̻@Ȼ@@@@L@lԻ@@L@]@a@b,@J@I8@u@@p@l@`@\@L@<@@@@.@@w@@@@sؽ@@<@ؿ@~Կ@@H@H@N@@F@@@@Ի@t@*@d@@@@|@ @l@ h@\@ @T@ @H@P@<@*@@.@(@@@@@@@@@@@@@@@C@@@@`@@wT@@<@@̼@l@h@X@Կ@L@H@<@@4@@(@̾@@"4@ @ @@!@@Ի@@@@sؽ@@\@p@l@@@t@*@d@@@@@@@A<@@@@@@,@@ @Ƚ@@@@$@@@P<@@x@@yh@@3@@2@@7@@8@@9l@@1@t@<@h@=p@\@?X@L@>H@<@5Ƚ@,@6̾@ @4@@;@:@@@@,@$@@@ @@@@@ @ @@S@R@@@@@J|@p@Kh@`@hX@WL@ D@<@ 4@ (@$@ @@@@@\@X@T@P@L@H@D@@@<@8@4@0@,@@@@@@|@p@h@`@@@@@@@@ @@@@4@8@P@l@@@o@v@m@@*@~@\aatadtastbstcatcdtcestcetcsteatedteesteetegstegtestgmtgsthktictidtistjst kst mdtmetmsdmskmstnzdt nzst pdtpstsatsmtsst utcwatwestwetwgstwgtwstAbEB EcEC&Ed@ED e!EEfEFg+G,hEiEk-L*El'm"En#ENOp(P)QR r@EsESTtEU vx%Ez$Ed@B`@*X@P@K@B@P@x@$@@K`@@B@@s@wx@K@@|@h@X@D@0@@L@A8@B$@C@D@E@F@G@H@I@J@K|@Ld@MH@M,@ @ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/AABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+@{}._-:%/ A|$ # # $ `tHtH HH<H H8 HHHH A# |# h# $ `tHtHHTH<H!HH8$H<&H<(H A# |# h# $ `tHtHHTH<H!HH8$H<&H<(H A# # 8$ d# `tHtH HH<H<*H,HHx0HH A# x# x# x# HPHx2H3H5H7H9HH,$ ,$ ,$ p$ p$ p$ # # ?- +<A$AAAAAAApALA<A(AA AAAAHAALAAPAAAA|@  @ H 8$HPHtH@,hHp@,Hp@ThH8  , Hp@ PȱH,`ȳHp@ H,HHX@$H8 @$H 8@$  HH8@$HTH8@$pܺHh8@$DH8@|@  @ H( ((H 8H,H$HX@,xHX@ H,HX@ HH,HX@ (H`,8HH@$hH0 @$|H0@$PH0@$(H0@$H\0 @$0H8@@A BCDEFGHIHHA@H,4DHHHHNFh$ pGHtG # - ܔD@CxGpHИD`DG PHG8GGPFd6F@HHFIFGHC=BBF@HBBȚG$$ GHH`HHBMB0HHG$'At$ # - `Fh aFfF`FHPGGFHGPRFH`EGsE G HhGGiFȁGH# # AB HHH The Registered Ports are not controlled by the IANA and on most systems #> can be used by ordinary user processes or programs executed by ordinary #> users. # #> Ports are used in the TCP [45,106] to name the ends of logical #> connections which carry long term conversations. For the purpose of #> providing services to unknown callers, a service contact port is #> defined. This list specifies the port used by the server process as its #> contact port. While the IANA can not control uses of these ports it #> does register or list uses of these ports as a convienence to the #> community. # ingreslock 1524/tcp ingreslock 1524/udp prospero-np 1525/tcp # Prospero non-privileged prospero-np 1525/udp datametrics 1645/tcp old-radius # datametrics / old radius entry datametrics 1645/udp old-radius # datametrics / old radius entry sa-msg-port 1646/tcp old-radacct # sa-msg-port / old radacct entry sa-msg-port 1646/udp old-radacct # sa-msg-port / old radacct entry radius 1812/tcp # Radius radius 1812/udp # Radius radacct 1813/tcp # Radius Accounting radacct 1813/udp # Radius Accounting cvspserver 2401/tcp # CVS client/server operations cvspserver 2401/udp # CVS client/server operations venus 2430/tcp # codacon port venus 2430/udp # Venus callback/wbc interface venus-se 2431/tcp # tcp side effects venus-se 2431/udp # udp sftp side effect codasrv 2432/tcp # not used codasrv 2432/udp # server port codasrv-se 2433/tcp # tcp side effects codasrv-se 2433/udp # udp sftp side effect mysql 3306/tcp # MySQL mysql 3306/udp # MySQL rfe 5002/tcp # Radio Free Ethernet rfe 5002/udp # Actually uses UDP only cfengine 5308/tcp # CFengine cfengine 5308/udp # CFengine bbs 7000/tcp # BBS service # # # Kerberos (Project Athena/MIT) services # Note that these are for Kerberos v4, and are unofficial. Sites running # v4 should uncomment these and comment out the v5 entries above. # kerberos4 750/udp kerberos-iv kdc # Kerberos (server) udp kerberos4 750/tcp kerberos-iv kdc # Kerberos (server) tcp kerberos_master 751/udp # Kerberos authentication kerberos_master 751/tcp # Kerberos authentication passwd_server 752/udp # Kerberos passwd server krb_prop 754/tcp # Kerberos slave propagation krbupdate 760/tcp kreg # Kerberos registration kpasswd 761/tcp kpwd # Kerberos "passwd" kpop 1109/tcp # Pop with Kerberos knetd 2053/tcp # Kerberos de-multiplexor zephyr-srv 2102/udp # Zephyr server zephyr-clt 2103/udp # Zephyr serv-hm connection zephyr-hm 2104/udp # Zephyr hostmanager eklogin 2105/tcp # Kerberos encrypted rlogin # # Unofficial but necessary (for NetBSD) services # supfilesrv 871/tcp # SUP server supfiledbg 1127/tcp # SUP debugging # # Datagram Delivery Protocol services # rtmp 1/ddp # Routing Table Maintenance Protocol nbp 2/ddp # Name Binding Protocol echo 4/ddp # AppleTalk Echo Protocol zip 6/ddp # Zone Information Protocol # # Services added for the Debian GNU/Linux distribution poppassd 106/tcp # Eudora poppassd 106/udp # Eudora mailq 174/tcp # Mailer transport queue for Zmailer mailq 174/tcp # Mailer transport queue for Zmailer ssmtp 465/tcp # SMTP over SSL gdomap 538/tcp # GNUstep distributed objects gdomap 538/udp # GNUstep distributed objects snews 563/tcp # NNTP over SSL ssl-ldap 636/tcp # LDAP over SSL omirr 808/tcp omirrd # online mirror omirr 808/udp omirrd # online mirror rsync 873/tcp # rsync rsync 873/udp # rsync simap 993/tcp # IMAP over SSL spop3 995/tcp # POP-3 over SSL socks 1080/tcp # socks proxy server socks 1080/udp # socks proxy server rmtcfg 1236/tcp # Gracilis Packeten remote config server xtel 1313/tcp # french minitel support 1529/tcp # GNATS cfinger 2003/tcp # GNU Finger ninstall 2150/tcp # ninstall service ninstall 2150/udp # ninstall service afbackup 2988/tcp # Afbackup system afbackup 2988/udp # Afbackup system icp 3130/tcp # Internet Cache Protocol (Squid) icp 3130/udp # Internet Cache Protocol (Squid) postgres 5432/tcp # POSTGRES postgres 5432/udp # POSTGRES fax 4557/tcp # FAX transmission service (old) hylafax 4559/tcp # HylaFAX client-server protocol (new) noclog 5354/tcp # noclogd with TCP (nocol) noclog 5354/udp # noclogd with UDP (nocol) hostmon 5355/tcp # hostmon uses TCP (nocol) hostmon 5355/udp # hostmon uses TCP (nocol) ircd 6667/tcp # Internet Relay Chat ircd 6667/udp # Internet Relay Chat webcache 8080/tcp # WWW caching service webcache 8080/udp # WWW caching service tproxy 8081/tcp # Transparent Proxy tproxy 8081/udp # Transparent Proxy mandelspawn 9359/udp mandelbrot # network mandelbrot amanda 10080/udp # amanda backup services kamanda 10081/tcp # amanda backup services (Kerberos) kamanda 10081/udp # amanda backup services (Kerberos) amandaidx 10082/tcp # amanda backup services amidxtape 10083/tcp # amanda backup services isdnlog 20011/tcp # isdn logging system isdnlog 20011/udp # isdn logging system vboxd 20012/tcp # voice box system vboxd 20012/udp # voice box system binkp 24554/tcp # Binkley binkp 24554/udp # Binkley asp 27374/tcp # Address Search Protocol asp 27374/udp # Address Search Protocol tfido 60177/tcp # Ifmail tfido 60177/udp # Ifmail fido 60179/tcp # Ifmail fido 60179/udp # Ifmail # Local services # /etc/protocols: # $Id: protocols,v 1.1 1995/02/24 01:09:41 imurdock Exp $ # # Internet (IP) protocols # # from: @(#)protocols 5.1 (Berkeley) 4/17/89 # # Updated for NetBSD based on RFC 1340, Assigned Numbers (July 1992). ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol igmp 2 IGMP # Internet Group Management ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st 5 ST # ST datagram mode tcp 6 TCP # transmission control protocol egp 8 EGP # exterior gateway protocol pup 12 PUP # PARC universal packet protocol udp 17 UDP # user datagram protocol hmp 20 HMP # host monitoring protocol xns-idp 22 XNS-IDP # Xerox NS IDP rdp 27 RDP # "reliable datagram" protocol iso-tp4 29 ISO-TP4 # ISO Transport Protocol class 4 xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 39 IDPR-CMTP # IDPR Control Message Transport rspf 73 RSPF #Radio Shortest Path First. vmtp 81 VMTP # Versatile Message Transport ospf 89 OSPFIGP # Open Shortest Path First IGP ipip 94 IPIP # Yet Another IP encapsulation encap 98 ENCAP # Yet Another IP encapsulation # # hosts This file describes a number of hostname-to-address # mappings for the TCP/IP subsystem. It is mostly # used at boot time, when no name servers are running. # On small systems, this file can be used instead of a # "named" name server. Just add the names, addresses # and any aliases to this file... # # Version: @(#)/etc/hosts 2.00 04/30/93 # # Author: Fred N. van Kempen, # # For loopbacking. 127.0.0.1 localhost 10.0.0.1 Elf.ucw.cz elf Elf 10.0.0.2 hobit.ucw.cz hobit 10.0.0.3 bug.ucw.cz bug 10.0.0.4 toy.ucw.cz toy 10.0.0.10 abacus.ucw.cz abacus 195.113.20.200 tserv.ms.mff.cuni.cz tserv 195.113.16.57 ulab-17.ms.mff.cuni.cz ulab-17 194.50.16.211 x.slip11.ms.mff.cuni.cz 194.50.16.212 x.slip12.ms.mff.cuni.cz 195.113.20.212 slip12.ms.mff.cuni.cz 193.84.91.235 lab-27.kolej.mff.cuni.cz potvora Potvora 147.32.192.12 k332.feld.cvut.cz k332 195.113.31.123 atrey.karlin.mff.cuni.cz atrey 194.50.19.66 ulab-5.ms.mff.cuni.cz ulab-5 u5 192.168.55.100 wince # End of hosts. # /etc/inetd.conf: see inetd(8) for further informations. # # Internet server configuration database # # # Lines starting with "#:LABEL:" or "##" should not # be changed unless you know what you are doing! # # If you want to disable an entry so it isn't touched during # package updates just comment it out with a single '#' character. # # Packages should modify this file by using update-inetd(8) # # # #:INTERNAL: Internal services echo stream tcp nowait root internal echo dgram udp wait root internal chargen stream tcp nowait root internal chargen dgram udp wait root internal discard stream tcp nowait root internal discard dgram udp wait root internal daytime stream tcp nowait root internal daytime dgram udp wait root internal time stream tcp nowait root internal time dgram udp wait root internal #:STANDARD: These are standard services. ftp stream tcp nowait root /usr/sbin/tcpd /usr/sbin/in.ftpd #telnet stream tcp nowait root /usr/sbin/tcpd /usr/sbin/in.telnetd telnet stream tcp nowait root /bin/telnetd /bin/telnetd #:BSD: Shell, login, exec and talk are BSD protocols. talk dgram udp wait nobody.tty /usr/sbin/tcpd /usr/sbin/in.talkd ntalk dgram udp wait nobody.tty /usr/sbin/tcpd /usr/sbin/in.ntalkd shell stream tcp nowait root /usr/sbin/tcpd /usr/sbin/in.rshd login stream tcp nowait root /usr/sbin/tcpd /usr/sbin/in.rlogind exec stream tcp nowait root /usr/sbin/tcpd /usr/sbin/in.rexecd #:MAIL: Mail, news and uucp services. smtp stream tcp nowait mail /usr/sbin/exim exim -bs #:INFO: Info services finger stream tcp nowait nobody /usr/sbin/tcpd /usr/sbin/in.fingerd ident stream tcp nowait nobody /usr/sbin/identd identd -i #:BOOT: Tftp service is provided primarily for booting. Most sites # run this only on machines acting as "boot servers." #tftp dgram udp wait nobody /usr/sbin/tcpd /usr/sbin/in.tftpd /boot #bootps dgram udp wait root /usr/sbin/bootpd bootpd -i -t 120 #:RPC: RPC based services #mountd/1 dgram rpc/udp wait root /usr/sbin/tcpd /usr/sbin/rpc.mountd #rstatd/1-3 dgram rpc/udp wait root /usr/sbin/tcpd /usr/sbin/rpc.rstatd #rusersd/2-3 dgram rpc/udp wait root /usr/sbin/tcpd /usr/sbin/rpc.rusersd #walld/1 dgram rpc/udp wait root /usr/sbin/tcpd /usr/sbin/rpc.rwalld #:HAM-RADIO: amateur-radio services #:OTHER: Other services netbios-ssn stream tcp nowait root /usr/sbin/tcpd /usr/sbin/smbd netbios-ns dgram udp wait root /usr/sbin/tcpd /usr/sbin/nmbd -a # /etc/inittab: init(8) configuration. # $Id: inittab,v 1.8 1998/05/10 10:37:50 miquels Exp $ # The default runlevel. id:S:initdefault: # Boot-time system configuration/initialization script. # This is run first except when booting in emergency (-b) mode. si::sysinit:/etc/init.d/rcS # What to do in single-user mode. ~~:S:wait:/sbin/sulogin # /etc/init.d executes the S and K scripts upon change # of runlevel. # # Runlevel 0 is halt. # Runlevel 1 is single-user. # Runlevels 2-5 are multi-user. # Runlevel 6 is reboot. l0:0:wait:/etc/init.d/rc 0 l1:1:wait:/etc/init.d/rc 1 l2:2:wait:/etc/init.d/rc 2 l3:3:wait:/etc/init.d/rc 3 l4:4:wait:/etc/init.d/rc 4 l5:5:wait:/etc/init.d/rc 5 l6:6:wait:/etc/init.d/rc 6 # Normally not reached, but fallthrough in case of emergency. z6:6:respawn:/sbin/sulogin # What to do when CTRL-ALT-DEL is pressed. ca:12345:ctrlaltdel:/sbin/shutdown -t1 -a -r now # Action on special keypress (ALT-UpArrow). kb::kbrequest:/bin/echo "Keyboard Request--edit /etc/inittab to let this work." # What to do when the power fails/returns. pf::powerwait:/etc/init.d/powerfail start pn::powerfailnow:/etc/init.d/powerfail now po::powerokwait:/etc/init.d/powerfail stop # /sbin/getty invocations for the runlevels. # # The "id" field MUST be the same as the last # characters of the device (after "tty"). # # Format: # ::: 1:23456:respawn:/sbin/sulogin /dev/tty1 2:23456:respawn:/sbin/sulogin /dev/tty2 3:23456:respawn:/sbin/sulogin /dev/tty3 4:23456:respawn:/sbin/sulogin /dev/tty4 5:23456:respawn:/sbin/sulogin /dev/tty5 6:23456:respawn:/sbin/sulogin /dev/tty6 #1:2345:respawn:/sbin/getty 38400 tty1 #2:23:respawn:/sbin/getty 38400 tty2 #3:23:respawn:/sbin/getty 38400 tty3 #4:23:respawn:/sbin/getty 38400 tty4 #5:23:respawn:/sbin/getty 38400 tty5 #6:23:respawn:/sbin/getty 38400 tty6 # Example how to put a getty on a serial line (for a terminal) # #T0:23:respawn:/sbin/getty -L ttyS0 9600 vt100 #T0:2345:respawn:/sbin/sulogin /dev/ttyS0 #T1:23:respawn:/sbin/getty -L ttyS1 9600 vt100 # Example how to put a getty on a modem line. # #T3:23:respawn:/sbin/mgetty -x0 -s 57600 ttyS3  . .. rcSrcrcS~ .#rcS#!/bin/sh echo "in rcS, got args $*" echo "starting emergency shell on tty11" sulogin /dev/tty11 & echo "mounting proc filesystem..." mount -n -t proc /proc /proc echo "remounting root as rw..." mount -n -o remount,rw / #/sbin/irmanager -d1 echo "adding loopback interface..." ifconfig lo 127.0.0.1 route add 127.0.0.0 gw 127.0.0.1 #ifconfig irda0 10.1.1.1 netmask 255.0.0.0 #route add -host 10.1.1.2 dev irda0 #/sbin/syslogd echo "setting up logging on tty12" /sbin/klogd -c 1 -f /dev/tty12 stty sane echo "starting inetd..." inetd echo "setting up slip..." ( sleep 20; echo "sl0 going up..."; ifconfig sl0 10.0.0.4 pointopoint 10.0.0.3 up; ifconfig; echo "mounting nfs..."; mount 10.0.0.3:/var/www /big -o soft,nolock,tcp; echo "running autorun"; /big/root/etc/autorun; echo "all done." ) > /dev/tty1 & slattach -p slip -s 115200 /dev/ttyS0 & echo "rcS done." #!/bin/sh echo "in rcS, got args $*" #!/bin/sh echo "in rcS, got args $*" echo "starting emergency shell on tty11" sulogin /dev/tty11 & sleep 1 echo "starting emergency shell on tty10" sulogin /dev/tty10 & sleep 1 echo "starting emergency shell on tty9" sulogin /dev/tty9 & echo "mounting proc filesystem..." mount -n -t proc /proc /proc echo "remounting root as rw..." mount -n -o remount,rw / #/sbin/irmanager -d1 echo "adding loopback interface..." ifconfig lo 127.0.0.1 route add 127.0.0.0 gw 127.0.0.1 #ifconfig irda0 10.1.1.1 netmask 255.0.0.0 #route add -host 10.1.1.2 dev irda0 #/sbin/syslogd echo "setting up logging on tty12" /sbin/klogd -c 1 -f /dev/tty12 stty sane echo "starting inetd..." inetd echo "setting up slip..." ( sleep 20; echo "sl0 going up..."; ifconfig sl0 10.0.0.4 pointopoint 10.0.0.3 up; ifconfig; echo "mounting nfs..."; mount 10.0.0.3:/var/www /big -o soft,nolock,tcp; echo "running autorun"; /big/root/etc/autorun; echo "all done." ) > /dev/tty1 & slattach -p slip -s 115200 /dev/ttyS0 & echo "rcS done." root::0:0:root:/root:/bin/sh daemon:x:1:1:daemon:/usr/sbin:/bin/sh bin:x:2:2:bin:/bin:/bin/sh sys:x:3:3:sys:/dev:/bin/sh sync:x:4:100:sync:/bin:/bin/sync games:x:5:100:games:/usr/games:/bin/sh man:x:6:100:man:/var/catman:/bin/sh lp:x:7:7:lp:/var/spool/lpd:/bin/sh mail:x:8:8:mail:/var/spool/mail:/bin/sh news:x:9:9:news:/var/spool/news:/bin/sh uucp:x:10:10:uucp:/var/spool/uucp:/bin/sh proxy:x:13:13:proxy:/bin:/bin/sh majordom:x:30:31:Majordomo:/usr/lib/majordomo:/bin/sh postgres:x:31:32:postgres:/var/postgres:/bin/sh www-data:x:33:33:www-data:/var/www:/bin/sh backup:x:34:34:backup:/var/backups:/bin/sh msql:x:36:36:Mini SQL Database Manager:/var/lib/msql:/bin/sh operator:x:37:37:Operator:/var:/bin/sh list:x:38:38:SmartList:/var/list:/bin/sh irc:x:39:39:ircd:/var:/bin/sh alias:x:70:65534:qmail alias:/var/qmail/alias:/bin/sh nobody:x:65534:65534:nobody:/home:/bin/sh root:x:0: daemon:x:1: bin:x:2: sys:x:3: adm:x:4: tty:x:5: disk:x:6: lp:x:7:lp mail:x:8: news:x:9: uucp:x:10: proxy:x:13: kmem:x:15: dialout:x:20: fax:x:21: voice:x:22: cdrom:x:24: floppy:x:25: tape:x:26: sudo:x:27: audio:x:29: dip:x:30: majordom:x:31:majordom postgres:x:32: www-data:x:33: backup:x:34: msql:x:36: operator:x:37: list:x:38: irc:x:39: src:x:40: gnats:x:41: shadow:x:42: staff:x:50: games:x:60: qmail:x:70: users:x:100: nogroup:x:65534: *.* /dev/console  ...!drivers"drivers~#network$ network.opts% network.opts~& network.orig'network.redhat(`printer#! /bin/sh # # drivers # # Initialize and shutdown IrDA device drivers. # # This script should be invoked with two arguments. The first is the # action to be taken, either "start", "stop", or "restart". # action=$1 device=$2 case "${action:?}" in 'start') #irattach /dev/ttyS2 # The third serial port is an IrDA port # irattach /dev/ttyS0 -d esi # Attach a ESI dongle to the first serial port # irattach /dev/ttyS0 -d tekram # insmod pc87108 # If your machine as a pc87108 FIR chipset # modprobe uircc # Sharp UIRCC chipset ;; 'stop') killall irattach # ... or something. Currently not used ;; 'restart') /sbin/ifconfig ${device:?} down up ;; esac #! /bin/sh # # drivers # # Initialize and shutdown IrDA device drivers. # # This script should be invoked with two arguments. The first is the # action to be taken, either "start", "stop", or "restart". # action=$1 device=$2 case "${action:?}" in 'start') #irattach /dev/ttyS2 # The third serial port is an IrDA port # irattach /dev/ttyS0 -d esi # Attach a ESI dongle to the first serial port # irattach /dev/ttyS0 -d tekram insmod pc87108 # If your machine as a pc87108 FIR chipset # modprobe uircc # Sharp UIRCC chipset ;; 'stop') killall irattach # ... or something. Currently not used ;; 'restart') /sbin/ifconfig ${device:?} down up ;; esac #! /bin/sh # # network # # Initialize or shutdown IrLAN ethernet device drivers # # This script should be invoked with two arguments. The first is the # action to be taken, either "start", "stop", or "restart". The # second is the network interface name. action=$1 device=$2 case "${action:?}" in 'start') /sbin/ifup ${device} ;; 'stop') /sbin/ifdown ${device} ;; 'restart') /sbin/ifconfig ${device:?} down up ;; esac # Network adapter configuration # # The address format is "scheme,socket,instance,hwaddr". # # Note: the "network address" here is NOT the same as the IP address. # See the Networking HOWTO. In short, the network address is the IP # address masked by the netmask. # case "$ADDRESS" in *,*,*,*) # Transceiver selection, for cards that need it -- see 'man ifport' IF_PORT="" # Use BOOTP [y/n] BOOTP="n" # IP address IPADDR="10.1.1.1" # Netmask NETMASK="255.255.0.0" # Network address NETWORK="10.1.0.0" # Broadcast address BROADCAST="10.1.255.255" # Gateway address GATEWAY="" # Domain name DOMAIN="" # Nameserver #1 DNS_1="" # Nameserver #2 DNS_2="" # Nameserver #3 DNS_3="" # NFS mounts, should be listed in /etc/fstab MOUNTS="" # For IPX interfaces, the frame type (i.e., 802.2) IPX_FRAME="" # For IPX interfaces, the network number IPX_NETNUM="" # Extra stuff to do after setting up the interface start_fn () { return; } # Extra stuff to do before shutting down the interface stop_fn () { return; } ;; esac # Network adapter configuration # # The address format is "scheme,socket,instance,hwaddr". # # Note: the "network address" here is NOT the same as the IP address. # See the Networking HOWTO. In short, the network address is the IP # address masked by the netmask. # case "$ADDRESS" in *,*,*,*) # Transceiver selection, for cards that need it -- see 'man ifport' IF_PORT="" # Use BOOTP [y/n] BOOTP="n" # IP address IPADDR="10.1.1.2" # Netmask NETMASK="255.255.255.0" # Network address NETWORK="10.1.0.0" # Broadcast address BROADCAST="10.1.255.255" # Gateway address GATEWAY="" # Domain name DOMAIN="" # Nameserver #1 DNS_1="" # Nameserver #2 DNS_2="" # Nameserver #3 DNS_3="" # NFS mounts, should be listed in /etc/fstab MOUNTS="" # For IPX interfaces, the frame type (i.e., 802.2) IPX_FRAME="" # For IPX interfaces, the network number IPX_NETNUM="" # Extra stuff to do after setting up the interface start_fn () { return; } # Extra stuff to do before shutting down the interface stop_fn () { return; } ;; esac #! /bin/sh # # network 1.43 1998/06/20 09:15:04 (David Hinds) # # Initialize or shutdown a PCMCIA ethernet adapter # # This script should be invoked with two arguments. The first is the # action to be taken, either "start", "stop", or "restart". The # second is the network interface name. # # The script passes an extended device address to 'network.opts' in # the ADDRESS variable, to retrieve device-specific configuration # options. The address format is "scheme,socket,instance,hwaddr" # where "scheme" is the current PCMCIA device configuration scheme, # "socket" is the socket number, "instance" is used to number multiple # interfaces in a single socket, and "hwaddr" is the card's hardware # ethernet address. # . ./shared # Get device attributes get_info $DEVICE HWADDR=`/sbin/ifconfig $DEVICE | sed -n -e 's/.*addr \(.*\)/\1/p'` # Load site-specific settings ADDRESS="$SCHEME,$SOCKET,$INSTANCE,$HWADDR" start_fn () { return; } stop_fn () { return; } . $0.opts RESOLV=/etc/resolv.conf case "$ACTION" in 'start') test "$IF_PORT" && /sbin/ifport $DEVICE $IF_PORT if is_true $BOOTP ; then /sbin/ifconfig $DEVICE up /sbin/route add default dev $DEVICE eval `/sbin/bootpc --bootfile '' --dev $DEVICE` /sbin/route del default if [ "$GATEWAYS" ] ; then set - $GATEWAYS ; GATEWAY=$1 fi fi if [ "$IPADDR" != "" ] ; then # Basic network setup BC=${BROADCAST:+broadcast $BROADCAST} /sbin/ifconfig $DEVICE up $IPADDR netmask $NETMASK $BC if [ "$NETWORK" != "" ] ; then /sbin/route add -net $NETWORK netmask $NETMASK dev $DEVICE elif [ "$GATEWAY" != "" ] ; then /sbin/route add $GATEWAY $DEVICE fi test "$GATEWAY" && /sbin/route add default gw $GATEWAY metric 1 # Update DNS stuff if [ "$DOMAIN$SEARCH$DNSSRVS$DNS_1$DNS_2$DNS_3" != "" ] ; then cp $RESOLV $RESOLV.N echo "# $DEVICE begin" >> $RESOLV.N test "$DOMAIN" && echo "domain $DOMAIN" >> $RESOLV.N test "$SEARCH" && echo "search $SEARCH" >> $RESOLV.N for DNS in $DNSSRVS $DNS_1 $DNS_2 $DNS_3 ; do echo "nameserver $DNS" >> $RESOLV.N done echo "# $DEVICE end" >> $RESOLV.N mv $RESOLV.N $RESOLV fi # Handle NFS mounts if [ "$MOUNTS" != "" ] ; then for MT in $MOUNTS ; do mount -v $MT ; done fi fi if [ "$IPX_NETNUM" != "" ] ; then ipx_interface add $DEVICE $IPX_FRAME $IPX_NETNUM fi start_fn $DEVICE ;; 'stop') stop_fn $DEVICE if is_true $BOOTP || [ "$IPADDR" != "" ] ; then # Shut down all NFS mounts on this interface nfsstop () { while read HOST MT ; do if /sbin/ifuser $DEVICE $HOST ; then fuser -s -k -m $MT umount -v $MT fi done } mount -t nfs | sed -e 's/:.* on \(.*\) type .*/ \1/' | nfsstop test "$IPX_NETNUM" && ipx_interface del $DEVICE $IPX_FRAME # Remove nameservers if fgrep -q "# $DEVICE begin" $RESOLV ; then sed -e "/# $DEVICE begin/,/# $DEVICE end/d" \ < $RESOLV > $RESOLV.N mv $RESOLV.N $RESOLV fi fi /sbin/ifconfig $DEVICE down ;; 'check') /sbin/ifconfig $DEVICE | grep -q RUNNING || exit 0 # Check for any in-use NFS mounts nfscheck () { while read HOST MT ; do /sbin/ifuser $DEVICE $HOST && fuser -sm $MT && exit 1 done } mount -t nfs | sed -e 's/:.* on \(.*\) type .*/ \1/' | nfscheck # Check for active TCP or UDP connections getdests () { IFS=" :" ; read A ; read A while read A B C D E HOST PORT STATE ; do if [ "$STATE" != "FIN_WAIT1" -a "$STATE" != "FIN_WAIT2" \ -a "$STATE" != "CLOSE_WAIT" -a "$STATE" != "TIME_WAIT" \ -a "$HOST" != "127.0.0.1" -a "$HOST" != "0.0.0.0" \ -a "$PORT" != "*" ] ; then echo $HOST fi done } DESTS=`netstat -ntuw | getdests` /sbin/ifuser $DEVICE $DESTS && exit 1 ;; 'cksum') chk_simple "$3,$SOCKET,$INSTANCE,$HWADDR" || exit 1 ;; 'restart') test "$IPADDR" && /sbin/ifconfig $DEVICE down up ;; 'suspend'|'resume') ;; *) usage ;; esac exit 0 #! /bin/sh # # network.sample $Revision: 1.1 $ $Date: 1999/02/08 23:09:56 $ (David Hinds) # # Initialize or shutdown a PCMCIA ethernet adapter # # This script should be invoked with two arguments. The first is the # action to be taken, either "start", "stop", or "restart". The # second is the network interface name. action=$1 device=$2 case "${action:?}" in 'start') /sbin/ifup ${device} ;; 'stop') /sbin/ifdown ${device} ;; 'restart') /sbin/ifconfig ${device:?} down up ;; esac #! /bin/sh # # printer (Dag Brattli) # # Initialize the printer device # # This script should be invoked with three arguments. The first is the # action to be taken, either "start", "stop", or "restart". The # second is the network interface name. The third is the minor number # used by the device action=$1 device=$2 minor=$3 if [ -z ${device} ]; then echo "$0: No device specified" exit 1 fi case "${action:?}" in 'start') rm -f /dev/${device}* mknod /dev/${device} c 10 `expr ${minor}` ;; 'stop') rm /dev/${device} ;; 'restart') ;; esac proc /proc proc defaults 0 0 ####### TERMINAL TYPE DESCRIPTIONS SOURCE FILE # # Version 9.8.1 # termcap syntax # # Heavilly stripped dumb:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: unknown:\ :gn:\ :tc=dumb: other|none of the above, but not exactly unknown:\ :am:gn:\ :co#80:\ :cl=^M^J:do=^J:ho=^M: arpanet|bussiplexer|dialup|ethernet|network|net|patch|plugboard|switch|network switch or dialup:\ :tc=unknown: lpr|printer|print|printing|line printer:\ :hc:os:\ :co#132:li#66:\ :bl=^G:cr=^M:do=^J:ff=^L:le=^H:sf=^J: #### ANSI terminals and terminal emulators # # See near the end of this file for details on ANSI conformance. # Don't mess with these entries! Lots of other entries depend on them! # # This section lists entries in a least-capable to most-capable order. # if you're in doubt about what `ANSI' matches yours, try them in that # order and back off from the first that breaks. # (ansi: changed ":pt:" to ":it#8:" -- esr) ansi-mini|any ansi terminal with pessimistic assumptions:\ :am:bs:\ :co#80:it#8:li#24:\ :ce=\E[K:cl=\E[;H\E[2J:cm=\E[%i%d;%dH:do=\E[B:\ :ho=\E[H:le=\E[D:nd=\E[C:up=\E[A: # Color controls corresponding to the ANSI.SYS de-facto standard # (This is not a standalone entry) ansi-pc-color:\ :Co#8:NC#3:pa#64:\ :AB=\E[4%dm:AF=\E[3%dm:\ :..Sb=\E[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m:\ :..Sf=\E[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m:\ :op=\E[37;40m: # Procomm and some other ANSI emulations don't recognize all of the ANSI- # standard capabilities. This entry deletes cuu, cuf, cud, cub, and vpa/hpa # capabilities, forcing curses to use repetitions of cuu1, cuf1, cud1 and cub1. # Also deleted ich and ich1, as QModem up to 5.03 doesn't recognize these. # Finally, we delete rep and ri, which seem to confuse many emulators. # On the other hand, we can count on these programs doing rmacs/smacs/sgr. # From: Eric S. Raymond July 25 1995 pcansi-mono|ibm-pc terminal programs claiming to be ansi (mono mode):\ :am:bs:mi:ms:pt:\ :co#80:it#8:li#24:\ :ae=\E[10m:al=\E[L:as=\E[12m:bl=^G:bt=\E[Z:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:ct=\E[2g:\ :dc=\E[P:dl=\E[M:do=\E[B:ho=\E[H:kb=^H:kd=\E[B:\ :kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mk=\E[9m:mr=\E[7m:nd=\E[C:\ :..sa=\E[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p8%t;11%;%?%p9%t;12%;m:\ :se=\E[m:sf=^J:so=\E[7m:st=\EH:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m: pcansi-mono25|ansi25m|ibm-pc terminal programs with 25 lines (mono mode):\ :li#25:\ :tc=pcansi-mono: pcansi-mono33|ansi33m|ibm-pc terminal programs with 33 lines (mono mode):\ :li#33:\ :tc=pcansi-mono: pcansi-mono43|ansi43m|ibm-pc terminal programs with 43 lines (mono mode):\ :li#43:\ :tc=pcansi-mono: # The color versions. All PC emulators do color... pcansi|ibm-pc terminal programs claiming to be ansi:\ :tc=ansi-pc-color:tc=pcansi-mono: pcansi-25|ansi25|ibm-pc terminal programs with 25 lines:\ :li#25:\ :tc=pcansi: pcansi-33|ansi33|ibm-pc terminal programs with 33 lines:\ :li#33:\ :tc=pcansi: pcansi-43|ansi43|ibm-pc terminal programs with 43 lines:\ :li#43:\ :tc=pcansi: # From: Eric S. Raymond Feb 3 1995 # ansi-mono -- full X.364 with ANSI.SYS-compatible attributes, no color. # Function-key mappings aren't in X3.64 but these are pretty standard. # If you want pound signs rather than dollars, replace `B' with `A' # in the s?ds capabilities. ansi-mono|ANSI X3.64-1979 terminal with ANSI.SYS compatible attributes:\ :5i:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[W:\ :F2=\E[X:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:cb=\E[1K:ch=\E[%dG:ct=\E[2g:\ :cv=\E[%dd:ec=\E[%dX:ei=:im=:k1=\E[M:k2=\E[N:k3=\E[O:\ :k4=\E[P:k5=\E[Q:k6=\E[R:k7=\E[S:k8=\E[T:k9=\E[U:\ :k;=\E[V:kB=\E[Z:kI=\E[L:kb=^H:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:me=\E[0;10m:nw=\r\E[S:pf=\E[4i:\ :po=\E[5i:..rp=%p1%c\E[%p2%{1}%-%db:s0=\E(B:s1=\E)B:\ :s2=\E*B:s3=\E+B:\ :..sa=\E[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p8%t;11%;%?%p9%t;12%;m:\ :ta=\E[I:tc=pcansi: # ansi -- this terminfo expresses the largest subset of X3.64 that will fit in # standard terminfo. Assumes ANSI.SYS-compatible attributes and color # From: Eric S. Raymond Feb 12 1995 ansi|ansi/pc-term compatible with color:\ :u6=\E[%d;%dR:u7=\E[6n:..u8=\E[?%[;0123456789]c:\ :u9=\E[c:tc=ansi-pc-color:tc=ansi-mono: # # ANSI.SYS entries # # Cannot use :pt:, it does not work (why?). :ho: seems required (why?). [gts] # Caution: 4.3 BSD tset does not pass li#25 to stty rows except during login? # :cl: clears attributes and sets wrap at margin before clearing the screen. # (ansi.sys: removed obsolete ":ma=^Hh^Jj^Kk^Ll^^H:" -- esr) # From: greg small ansi.sys|ansisys|PC-DOS 3.1 ANSI.SYS:\ :am:bs:ms:\ :co#80:li#25:\ :ae=\E[10:as=\E[12:ce=\E[K:cl=\E[m\E[7h\E[2J:\ :cm=\E[%i%d;%dH:ho=\E[H:\ :is=U1 PC-DOS 3.1 ANSI.SYS 9-23-86\n\E[m\E[7h:kd=^J:\ :kh=^^:kl=^H:kr=^L:ku=^K:md=\E[1m:me=\E[0;10m:\ :mr=\E[7m:nd=\E[C:se=\E[m:so=\E[1m:ue=\E[m:up=\E[A:\ :us=\E[4m: # # Define IBM PC keypad keys for vi as per MS-Kermit while using ANSI.SYS. # This should only be used when the terminal emulator cannot redefine the keys. # Since redefining keys with ansi.sys also affects PC-DOS programs, the key # definitions must be restored. If the terminal emulator is quit while in vi # or others using :ks:ke:, the keypad keys will not be defined as per PC-DOS. # The PgUp and PgDn are prefixed with ESC so that tn3270 can be used on Unix # (^U and ^D are already defined for tn3270). The ESC is safe for vi but it # does "beep". ESC ESC i is used for Ins to avoid tn3270 ESC i for coltab. # Left arrow is always BS, because PC-dos can tolerate this change. # Caution: vi is limited to 256 string bytes, longer crashes or weirds out vi. # Consequently the End keypad key could not be set (it is relatively safe and # actually useful because it sends ^@ O, which beeps and opens a line above). ansi.sysk|ansisysk|PC-DOS 3.1 ANSI.SYS with keypad redefined for vi:\ :is=U2 PC-DOS 3.1 ANSI.SYS with keypad redefined for vi 9-29-86\n\E[;75;8p:\ :ke=\E[;71;0;71p\E[;72;0;72p\E[;73;0;73p\E[;77;0;77p\E[;80;0;80p\E[;81;0;81p\E[;82;0;82p\E[;83;0;83p:\ :ks=\E[;71;30p\E[;72;11p\E[;73;27;21p\E[;77;12p\E[;80;10p\E[;81;27;4p\E[;82;27;27;105p\E[;83;127p:tc=ansi.sys: # # Adds ins/del line/character, hence vi reverse scrolls/inserts/deletes nicer. nansi.sys|nansisys|PC-DOS Public Domain NANSI.SYS:\ :al=\E[1L:dc=\E[1P:dl=\E[1M:ei=:ic=\E[1@:im=:\ :is=U3 PC-DOS Public Domain NANSI.SYS 9-23-86\n:tc=ansi.sys: # # See ansi.sysk and nansi.sys above. nansi.sysk|nansisysk|PC-DOS Public Domain NANSI.SYS with keypad redefined for vi:\ :al=\E[1L:dc=\E[1P:dl=\E[1M:ei=:ic=\E[1@:im=:\ :is=U4 PC-DOS Public Domain NANSI.SYS with keypad redefined for vi 9-29-86\n\E[;75;8p:tc=ansi.sysk: #### ANSI console types # # This entry is good for the 1.1.47 version of the Linux console driver. # # It assumes that you want A_PROTECT mapped to the alternate character set # mode that permits IBM ROM characters to be displayed (this is the assumption # used by ncurses version 1.9 and after, in order not to collide with the # internationalization attribute values specified in the XSI Curses standard). # # We use \E11m for rmacs rather than \E12m so the acsc string can use the ROM # graphics for control characters such as the diamond, up arrow and down-arrow. # This trick could work with other Intel consoles like the att6386 and pc3. # # Note: there are numerous broken linux entries out there, which didn't screw # up BSD termcap but hose ncurses's smarter cursor-movement optimization. # One common pathology is an incorrect tab length of 4. Also note that the # hpa=\E[%dG/vpa=\E[%dd capabilities seem not to be reliable. To reproduce # the bug, re-introduce them and run worm -T 200 212 from the ncurses # test suite, save the trace, then worm -N -T 200 212. Observe that the first # run fails to properly delete some worm segments, then diff the trace files. # # From: Eric S. Raymond 23 July 1995 linux|linux console:\ :am:bs:eo:mi:ms:ut:xn:xo:\ :Co#8:co#80:it#8:li#25:pa#64:\ :&7=^Z:@7=\E[4~:AB=\E[4%dm:AF=\E[3%dm:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F5=\E[28~:F6=\E[29~:F7=\E[31~:\ :F8=\E[32~:F9=\E[33~:FA=\E[34~:IC=\E[%d@:K2=\E[G:\ :S2=\E[11m:S3=\E[10m:Sb=\E[%+(m:Sf=\E[%+^^m:\ :ac=`\004a\261f\370g\361h\260j\331k\277l\332m\300n\305o~q\304r\362s_t\303u\264v\301w\302x\263y\371z\372{\373|\374}\375~\376.\031-\030\054\021+^P0\333:\ :ae=\E[10m:al=\E[L:as=\E[11m:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :ic=\E[@:im=\E[4h:k1=\E[[A:k2=\E[[B:k3=\E[[C:\ :k4=\E[[D:k5=\E[[E:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:\ :kP=\E[5~:kb=^H:kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[0;10m:\ :mr=\E[7m:nd=\E[C:nw=^M^J:op=\E[37;40m:r1=\Ec:rc=\E8:\ :..sa=\E[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p8%t;11%;%?%p9%t;11%;m:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :u6=\E[%d;%dR:u7=\E[6n:u8=\E[?6c:u9=\E[c:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l:ve=\E[?25h:\ :vi=\E[?25l: linux-mono|Linux console, no color:\ :Co@:pa@:\ :AB@:Sb@:Sf@:tc=linux: # See the note on ICH/ICH1 VERSUS RMIR/SMIR near the end of file linux-nic|linux with ich/ich1 suppressed for non-curses programs:\ :IC@:ei=:ic@:im=:tc=linux: #### DEC VT100 and compatibles # # DEC terminals from the vt100 forward are collected here. Older DEC terminals # and micro consoles can be found in the `obsolete' section. More details # on the relationship between the VT100 and ANSI X3.64 may be found near the # end of this file. # # Except where noted, these entries are DEC's official terminfos. # Contact Bill Hedberg of Terminal Support # Engineering for more information. Updated terminfos and termcaps # are kept available at ftp://gatekeeper.dec.com/pub/DEC/termcaps. # # Note that the xenl glitch in vt100 is not quite the same as on the Concept, # since the cursor is left in a different position while in the # weird state (concept at beginning of next line, vt100 at end # of this line) so all versions of vi before 3.7 don't handle # xenl right on vt100. The correct way to handle xenl is when # you output the char in column 80, immediately output CR LF # and then assume you are in column 1 of the next line. If xenl # is on, am should be on too. # # I assume you have smooth scroll off or are at a slow enough baud # rate that it doesn't matter (1200? or less). Also this assumes # that you set auto-nl to "on", if you set it off use vt100-nam # below. # # The padding requirements listed here are guesses. It is strongly # recommended that xon/xoff be enabled, as this is assumed here. # # The vt100 uses rs2 and rf rather than is2/tbc/hts because the # tab settings are in non-volatile memory and don't need to be # reset upon login. Also setting the number of columns glitches # the screen annoyingly. You can type "reset" to get them set. # # This is how the keypad gets assigned in Application Keypad mode. # PF1 = kf1 PF2 = kf2 PF3 = kf3 PF4 = kf4 # 7 = kf9 8 = kf10 9 = kf0 - # 4 = kf5 5 = kf6 6 = kf7 , = kf8 # 1 = ka1 2 = kb2 3 = ka3 # 0 = kc1 . = kc3 ENTER = kent # vt100|vt100-am|dec vt100 (w/advanced video):\ :am:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:\ :K5=\EOn:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:do=^J:eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:\ :k8=\EOl:k9=\EOw:k;=\EOx:kb=^H:kd=\EOB:ke=\E[?1l\E>:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m\017:mr=\E[7m:nd=\E[C:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\]^_`abcdefghijklmnopE[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[1;7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: vt100nam|vt100-nam|vt100 w/no am (w/advanced video):\ :am@:xn@:\ :tc=vt100-am: # Ordinary vt100 in 132 column ("wide") mode. vt100-w|vt100-w-am|dec vt100 132 cols (w/advanced video):\ :co#132:li#24:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-am: vt100-w-nam|vt100-nam-w|dec vt100 132 cols (w/advanced video):\ :co#132:li#14:vt@:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-nam: # vt100 with no advanced video. vt100-nav|vt100 without advanced video option:\ :sg#1:\ :mb@:md@:me@:mr@:sa@:se=\E[m:so=\E[7m:ue@:us@:tc=vt100: vt100-nav-w|vt100-w-nav|dec vt100 132 cols 14 lines (no advanced video option):\ :co#132:li#14:\ :tc=vt100-nav: # vt100 with one of the 24 lines used as a status line. # We put the status line on the top. vt100-s|vt100-s-top|vt100-top-s|vt100 for use with sysline:\ :es:hs:\ :li#23:\ :cl=\E[2;1H\E[J:cm=\E[%i%+^A;%dH:cs=\E[%i%i%d;%dr:\ :ds=\E7\E[1;24r\E8:fs=\E8:ho=\E[2;1H:\ :is=\E7\E[2;24r\E8:ts=\E7\E[1;%dH\E[1K:tc=vt100-am: # Status line at bottom. # Clearing the screen will clobber status line. vt100-s-bot|vt100-bot-s|vt100 for use with sysline:\ :es:hs:\ :li#23:\ :ds=\E7\E[1;24r\E8:fs=\E8:is=\E[1;23r\E[23;1H:\ :ts=\E7\E[24;%dH\E[1K:tc=vt100-am: # DEC VT100 with Advanced Video Option -- NOT DEC'S ENTRY!!! # This may be used as an alternate vt102 entry; it's probably better than the # stock one if you can live with XON/XOFF. All the AVO gave you was smul/rmul. # From: Doug Gwyn 25 Jan 93 # The following SET-UP modes are assumed for normal operation: # ANSI_MODE AUTO_XON/XOFF_ON NEWLINE_OFF 80_COLUMNS # WRAP_AROUND_ON # Other SET-UP modes may be set for operator convenience or communication # requirements; I recommend # SMOOTH_SCROLL AUTOREPEAT_ON BLOCK_CURSOR MARGIN_BELL_OFF # SHIFTED_3_# # Unless you have a graphics add-on such as Digital Engineering's VT640 # (and even then, whenever it can be arranged!) you should set # INTERLACE_OFF # Hardware tabs are assumed to be set every 8 columns; they can be set up # by the "reset", "tset", or "tabs" utilities (use vt100-x, 132 columns, for # this). I have included some compatible code in "rs" for the VT640 if you # have one. No delays are specified; use "stty ixon -ixany" to enable DC3/DC1 # flow control! # Thanks to elsie!ado (Arthur David Olson) for numerous improvements. vt100-avo|DEC VT100 with AVO:\ :ms:xo:\ :co#80:it#8:li#24:vt#3:\ :DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:as=^N:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:ho=\E[H:\ :is=\E<\E)0:k0=\EOP:k1=\EOQ:k2=\EOR:k3=\EOS:kb=^H:\ :kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l0=PF1:l1=PF2:l2=PF3:l3=PF4:le=^H:ll=\E[24H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:\ :rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:\ :ta=^I:te=150\E[?7h:ti=\E[?7l:ue=\E[m:up=\EM:\ :us=\E[4m: # Most of the `vt100' emulators out there actually emulate a vt102 # This entry (or vt102-nsgr) is probably the right thing to use for # these. vt102|dec vt102:\ :mi:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:tc=vt100: # Many brain-dead PC comm programs that pretend to be `vt100-compatible' # fail to interpret the ^O and ^N escapes properly. Symptom: the sgr0 # string in the canonical vt100 entry above leaves the screen littered # with little snowflake or star characters (IBM PC ROM character \017 = ^O) # after highlight turnoffs. This entry should fix that, and even leave # ACS support working, at the cost of making multiple-highlight changes # slightly more expensive. # From: Eric S. Raymond July 22 1995 vt102-nsgr|dec vt102 with ACS support disabled:\ :me=\E[m:sa@:tc=vt102: # VT125 Graphics CRT. Clear screen also erases graphics vt125|vt125 graphics terminal:\ :cl=\E[;H\E[2J\EPpS(E)\E\\:tc=vt100: # vt132 - like vt100 but slower and has ins/del line and such. # I'm told that smir/rmir are backwards in the terminal from the # manual and from the ANSI standard, this describes the actual # terminal. I've never actually used a vt132 myself, so this # is untested. # vt132|DEC vt132:\ :xn:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4h:im=\E[4l:ip=:sf=\n:tc=vt100: # vt220: # This vt220 description maps F5--F9 to the second block of function keys # at the top of the keyboard. The "DO" key is used as F10 to avoid conflict # with the key marked (ESC) on the vt220. See vt220d for an alternate mapping. # PF1--PF4 are used as F1--F4. # vt220|DEC VT220 in vt100 emulation mode:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:ac=kkllmmjjnnwwqquuttvvxx:ae=\E(B:al=\E[L:\ :as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=\E[4l:ho=\E[H:if=/usr/lib/tabset/vt100:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:\ :k8=\E[20~:k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:kh=\E[1~:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/lib/tabset/vt100:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: # # vt220d: # This vt220 description regards F6--F10 as the second block of function keys # at the top of the keyboard. This mapping follows the description given # in the VT220 Programmer Reference Manual and agrees with the labeling # on some terminals that emulate the vt220. There is no support for an F5. # See vt220 for an alternate mapping. # vt220d|DEC VT220 in vt100 mode with DEC function key labeling:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:\ :k5@:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:tc=vt220: vt220nam|vt220-nam|v220n|VT220 in vt100 mode with no auto margins:\ :am@:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: vt220-8|dec vt220 8 bit terminal:\ :5i:am:mi:ms:xn:xo:\ :co#80:it#8:li#24:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=\E[L:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:ec=\E[%dX:\ :ei=\E[4l:ho=\E[H:if=/usr/lib/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:pf=\E[4i:po=\E[5i:\ :ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l: vt320|DEC VT320 in vt100 emulation mode:\ :tc=vt220: # # Use v320n for LYRIX # vt320nam|vt320-nam|v320n|DEC VT320 in vt100 emul. mode with NO AUTO WRAP mode:\ :am@:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: vt420|DEC VT420:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[;H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/lib/tabset/vt100:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k0=\E[29~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:\ :k7=\E[19~:k8=\E[20~:k9=\E[21~:k;=\E[29~:kD=\E[3~:\ :kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:ke=\E>:\ :kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/lib/tabset/vt100:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt420nam|vt420-nam|v420n|DEC VT420 in vt100 emul. mode with NO AUTO WRAP mode:\ :am@:\ :tc=vt420: # # DECUDK # if (key < 16) then value = key; # else if (key < 21) then value = key + 1; # else if (key < 25) then value = key + 2; # else if (key < 27) then value = key + 3; # else if (key < 30) then value = key + 4; # else value = key + 5; # vt420pc|DEC VT420 w/PC keyboard:\ :@7=\E[4~:F1=\E[23~:F2=\E[24~:F3=\E[11;2~:\ :F4=\E[12;2~:F5=\E[13;2~:F6=\E[14;2~:F7=\E[15;2~:\ :F8=\E[17;2~:F9=\E[18;2~:FA=\E[19;2~:FB=\E[20;2~:\ :FC=\E[21;2~:FD=\E[23;2~:FE=\E[24;2~:FF=\E[23~:\ :FG=\E[24~:FH=\E[25~:FI=\E[26~:FJ=\E[28~:FK=\E[29~:\ :FL=\E[31~:FM=\E[32~:FN=\E[33~:FO=\E[34~:FP=\E[35~:\ :FQ=\E[36~:FR=\E[23;2~:FS=\E[24;2~:FT=\E[25;2~:\ :FU=\E[26;2~:FV=\E[28;2~:FW=\E[29;2~:FX=\E[31;2~:\ :FY=\E[32;2~:FZ=\E[33;2~:Fa=\E[34;2~:Fb=\E[35;2~:\ :Fc=\E[36;2~:S6=USR_TERM\072vt420pcdos\072:k1=\E[11~:\ :k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:\ :k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:kD=^_:\ :kh=\E[H:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:tc=vt420: vt420pcdos|DEC VT420 w/PC for DOS Merge:\ :li#25:\ :S1=%?%p2%{19}%=%t\E\023\021%e%p2%{32}%<%t\E%p2%c%e%p2%{127}%=%t\E\177%e%p2%c%;:\ :S4=\E[?1;2r\E[34h:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:S6@:\ :me=\E[0m:sa@:tc=vt420pc: vt420f|DEC VT420 with VT kbd; VT400 mode; F1-F5 used as Fkeys:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :kD=^_:kh=\E[H:l1=\EOP:l2=\EOQ:l3=\EOR:l4=\EOS:tc=vt420: vt420f-nam|v420fn|DEC VT420 no auto margins:\ :am@:\ :tc=vt420f: vt420pc-nam|v420pcn|DEC VT420 PC keyboard no auto margins:\ :am@:\ :tc=vt420pc: vt510|DEC VT510:\ :tc=vt420: vt510nam|vt510-nam|v510n|DEC VT510 in vt100 emul. mode with NO AUTO WRAP mode:\ :tc=vt420nam: vt510pc|DEC VT510 w/PC keyboard:\ :tc=vt420pc: vt510pc-nam|v510pcn|DEC VT510 PC keyboard no auto margins:\ :am@:\ :tc=vt420pc: vt510pcdos|DEC VT510 w/PC for DOS Merge:\ :tc=vt420pcdos: # VT520/VT525 # # The VT520 is a monochrome text terminal capable of managing up to # four independent sessions in the terminal. It has multiple ANSI # emulations (VT520, VT420, VT320, VT220, VT100, VT PCTerm, SCO Console) # and ASCII emulations (WY160/60, PCTerm, 50/50+, 150/120, TVI 950, # 925 910+, ADDS A2). This terminfo data is for the ANSI emulations only. # # Terminal Set-Up is entered by pressing [F3], [Caps Lock]/[F3] or # [Alt]/[Print Screen] depending upon which keyboard and which # terminal mode is being used. If Set-Up has been disabled or # assigned to an unknown key, Set-Up may be entered by pressing # [F3] as the first key after power up, regardless of keyboard type. vt520|DEC VT520:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[;H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/lib/tabset/vt100:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k0=\E[29~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:\ :k7=\E[19~:k8=\E[20~:k9=\E[21~:k;=\E[29~:kD=\E[3~:\ :kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/lib/tabset/vt100:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt520nam|vt520-nam|v520n|DEC VT520 with NO AUTO WRAP:\ :am@:\ :tc=vt520: vt525|DEC VT525:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[;H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/lib/tabset/vt100:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k0=\E[29~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:\ :k7=\E[19~:k8=\E[20~:k9=\E[21~:k;=\E[29~:kD=\E[3~:\ :kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/lib/tabset/vt100:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt525nam|vt525-nam|v525n|DEC VT525 with NO AUTO WRAP:\ :am@:\ :tc=vt525: #### Xterm variants # # X10/6.6 11/7/86, minus alternate screen, plus (csr) # (xterm: ":MT:" changed to ":km:"; mapped ":pt:" to ":it#8:"; # removed (hs, eslok, tsl=\E[?E\E[?%i%dT, fsl=\E[?F, dsl=\E[?E) # as these seem not to work -- esr) x10term|vs100-x10|xterm terminal emulator (X10 window system):\ :am:bs:km:mi:ms:pt:xn:xo:\ :co#80:it#8:li#65:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:al=\E[L:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E\E[m\E[?7h\E[?1;4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:\ :rs=\E[r\E<\E[m\E[H\E[2J\E[?7h\E[?1;3;4;6l:se=\E[m:\ :sf=^J:so=\E[7m:sr=\EM:ue=\E[m:up=\E[A:us=\E[4m: # X11R6 xterm. This is known good for the XFree86 version under Linux. # From: Eric S. Raymond 9 Jul 1995 # Note: If you use the line-drawing character set, the disable afterwards # will leave you in US-ASCII. If you live somewhere that wants a pound sign # at 2/3, change rmacs to "\E(A". Further note: cuf and cub don't seem # to be reliable under my xterm, so they're commented out. Final note: # Older versions of this entry set/reset application keypad mode (\EO-prefix # cursor keys) in the [sr]mkx caps, but it wasn't necessary, and doesn't # actually fit the terminfo model properly. xterm|xterm-color|vs100|xterm terminal emulator (X11R6 Window System):\ :am:bs:km:mi:ms:pt:xn:xo:\ :co#80:it#8:li#65:\ :@7=\E[[:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:F1=\E[23~:\ :F2=\E[24~:IC=\E[%d@:LE=\E[%dD:UP=\E[%dA:\ :ac=++\054\054..00II--``aaffgghhjjkkllmmnnooqqssttuuvvwwxx~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3k:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :ic=\E[@:im=\E[4h:\ :is=\E[r\E[m\E[2J\E[H\E[?7h\E[?1;3;4;6l\E[4l:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:kh=\E[@:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:\ :r2=\E[r\E[m\E[2J\E[H\E[?7h\E[?1;3;4;6l\E[4l\E<:\ :rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:ta=^I:\ :te=\E[2J\E[?47l\E8:ti=\E7\E[?47h:u6=\E[%d;%dR:\ :u7=\E[6n:u8=\E[?1;2c:u9=\E[c:ue=\E[m:up=\E[A:\ :us=\E[4m: xterm24|vs100-24|xterm terminal emulator (24 lines) (X11R6 window system):\ :co#80:li#24:\ :tc=xterm: xterm25|vs100-25|xterm terminal emulator (25 lines) (X11R6 window system):\ :co#80:li#25:\ :tc=xterm: xterm50|vs100-50|xterm terminal emulator (50 lines) (X11R6 window system):\ :co#80:li#50:\ :tc=xterm: xterms|vs100s|xterm terminal emulator (small) (X11R6 window system):\ :tc=xterm24: # (kterm: this had unknown capabilities ":KJ:TY=ascii:" -- esr) kterm|kterm kanji terminal emulator (X window system):\ :es:hs:\ :cs=\E[%i%d;%dr:ds=\E[?H:fs=\E[?F:rc=\E8:sc=\E7:\ :ts=\E[?E\E[?%i%dT:tc=xterm: # See the note on ICH/ICH1 VERSUS RMIR/SMIR near the end of file xterm-nic|xterm with ich/ich1 suppressed for non-curses programs:\ :IC@:ei=:ic@:im=:tc=xterm: # From: Eric S. Raymond May 4 1995 # Should work with the color xterm on the X11R6 contrib tape. xterm-color|xterm with color support:\ :tc=xterm:tc=ansi-pc-color: # From: David J. MacKenzie 20 Apr 1995 # Here's a termcap entry I've been using for xterm_color, which comes # with BSD/OS 2.0, and the X11R6 contrib tape too I think. Besides the # color stuff, I also have a status line defined as the window manager # title bar. [I have translated it to terminfo -- ESR] xterm-pcolor|xterm with color used for highlights and status line:\ :hs:\ :ws#40:\ :ds=\E]0;\007:fs=^G:md=\E[1m\E[43m:mr=\E[7m\E[34m:\ :so=\E[7m\E[31m:ts=\E]0;:us=\E[4m\E[42m:tc=xterm: ######## UNIX VIRTUAL TERMINALS AND VIRTUAL CONSOLES # # Columbus UNIX virtual terminal. This terminal also appears in # UNIX 4.0 and successors as line discipline 1 (?), but is # undocumented and does not really work quite right. cbunix|cb unix virtual terminal:\ :am:bs:da:db:\ :co#80:li#24:lm#0:\ :al=\EP:bl=^G:cd=\EL:ce=\EK:cl=\EL:cm=\EG%r%.%.:\ :cr=^M:dc=\EM:dl=\EN:do=^J:ei=:ic=\EO:im=:kd=\EB:\ :kh=\EE:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:se=\Eb^D:\ :sf=^J:so=\Ea^D:ue=\Eb^A:up=\EA:us=\Ea^A: # (vremote: removed obsolete ":nl@:" -- esr) vremote|virtual remote terminal:\ :am@:\ :co#79:\ :tc=cbunix: pty|4bsd pseudo teletype:\ :cm=\EG%+ %+ :se=\Eb$:so=\Ea$:ue=\Eb!:us=\Ea!:tc=cbunix: # Entries for use by the FSF's `screen' program. These came with version 3.6.2 screen|VT 100/ANSI X3.64 virtual terminal:\ :am:km:mi:ms:xn:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:\ :F2=\E[24~:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~..--++\054\054hhII00:\ :ae=^O:al=\E[L:as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :im=\E[4h:is=\E)0:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[15~:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kH=\E[4~:kI=\E[2~:kN=\E[6~:\ :kP=\E[5~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:r2=\Ec:\ :rc=\E8:sc=\E7:se=\E[23m:sf=^J:so=\E[3m:sr=\EM:\ :st=\EH:ta=^I:ue=\E[24m:up=\EM:us=\E[4m: screen-w|VT 100/ANSI X3.64 virtual terminal with 132 cols:\ :am:km:mi:ms:xn:\ :co#132:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:\ :F2=\E[24~:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~..--++\054\054hhII00:\ :ae=^O:al=\E[L:as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :im=\E[4h:is=\E)0:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[15~:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kH=\E[4~:kI=\E[2~:kN=\E[6~:\ :kP=\E[5~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:r2=\Ec:\ :rc=\E8:sc=\E7:se=\E[23m:sf=^J:so=\E[3m:sr=\EM:\ :st=\EH:ta=^I:ue=\E[24m:up=\EM:us=\E[4m: # Test Termcap test|Dummy terminal for testing:\ :rp=R%.%d:co#200:li#150:cm=M%d,%d:ho=H:ll=L:cr=C:le=l:\ :nd=r:up=u:do=d:bw:nw=n:LE=ml%d:RI=mr%d:UP=mu%d:DO=md%d:\ :ch=xxxy%d:cv=x%d:ta=T:bt=B:am:xn:sf=.sf:sr=.sr:SF=.SF:SR=.SR:\ :cs=.cs%d,%d:cS=.cS%d,%d,%d,%d:wi=.wi%d,%d,%d,%d:cl=.cls:\ :cd=.ceos:ce=E:ec=c%d:al=.al:dl=.dl:AL=.AL%d:DL=.DL%d:\ :im=I:ei=i:ic=W:IC=.IC%d:mi:dc=D:DC=.DC%d:dm=.DM:ed=.ED:\ :so=bs:se=es:ms:mb=bf:md=bb:mh=bd:mk=bi:mp=bp:mr=br:me=e*:\ :as=ba:ae=ea:sa=.SA%d%d%d%d%d%d%d%d%d:us=bu:ue=eu:vs=.VS:\ :vi=.VI:ve=.VE:bl=.BL:vb=.VB:ks=.KS:ke=.KE:km:mm=.MM:mo=.MO:\ :ti=.TI:te=.TE:is=.IS:if=.IF:rs=.RS:it#8:ct=.CT:st=.ST:\ :ZH=bI:ZR=eI:ZM=bS:ZU=eS:AB=cB%d:AF=cF%d:S2=bP:S3=eP:ut:Co#16: # /etc/inittab: init(8) configuration. # $Id: inittab,v 1.8 1998/05/10 10:37:50 miquels Exp $ # The default runlevel. id:S:initdefault: # Boot-time system configuration/initialization script. # This is run first except when booting in emergency (-b) mode. si::sysinit:/etc/init.d/rcS # What to do in single-user mode. ~~:S:wait:/sbin/sulogin # /etc/init.d executes the S and K scripts upon change # of runlevel. # # Runlevel 0 is halt. # Runlevel 1 is single-user. # Runlevels 2-5 are multi-user. # Runlevel 6 is reboot. l0:0:wait:/etc/init.d/rc 0 l1:1:wait:/etc/init.d/rc 1 l2:2:wait:/etc/init.d/rc 2 l3:3:wait:/etc/init.d/rc 3 l4:4:wait:/etc/init.d/rc 4 l5:5:wait:/etc/init.d/rc 5 l6:6:wait:/etc/init.d/rc 6 # Normally not reached, but fallthrough in case of emergency. z6:6:respawn:/sbin/sulogin # What to do when CTRL-ALT-DEL is pressed. ca:12345:ctrlaltdel:/sbin/shutdown -t1 -a -r now # Action on special keypress (ALT-UpArrow). kb::kbrequest:/bin/echo "Keyboard Request--edit /etc/inittab to let this work." # What to do when the power fails/returns. pf::powerwait:/etc/init.d/powerfail start pn::powerfailnow:/etc/init.d/powerfail now po::powerokwait:/etc/init.d/powerfail stop # /sbin/getty invocations for the runlevels. # # The "id" field MUST be the same as the last # characters of the device (after "tty"). # # Format: # ::: 1:2345:respawn:/sbin/sulogin /dev/tty1 2:2345:respawn:/sbin/sulogin /dev/tty2 3:2345:respawn:/sbin/sulogin /dev/tty3 4:2345:respawn:/sbin/sulogin /dev/tty4 5:2345:respawn:/sbin/sulogin /dev/tty5 6:2345:respawn:/sbin/sulogin /dev/tty6 #1:2345:respawn:/sbin/getty 38400 tty1 #2:23:respawn:/sbin/getty 38400 tty2 #3:23:respawn:/sbin/getty 38400 tty3 #4:23:respawn:/sbin/getty 38400 tty4 #5:23:respawn:/sbin/getty 38400 tty5 #6:23:respawn:/sbin/getty 38400 tty6 # Example how to put a getty on a serial line (for a terminal) # #T0:23:respawn:/sbin/getty -L ttyS0 9600 vt100 #T0:2345:respawn:/sbin/sulogin /dev/ttyS0 #T1:23:respawn:/sbin/getty -L ttyS1 9600 vt100 # Example how to put a getty on a modem line. # #T3:23:respawn:/sbin/mgetty -x0 -s 57600 ttyS3 # # Copyright (c) 1983, 1995 Eric P. Allman # Copyright (c) 1988, 1993 # The Regents of the University of California. All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the University of # California, Berkeley and its contributors. # 4. Neither the name of the University nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # level 7 config file format V7/Berkeley ################## # local info # ################## Cwlocalhost # my official domain name # ... define this only if sendmail cannot automatically determine your domain Djtoy.ucw.cz CP. # UUCP relay host DYbeba.cesnet.cz CPUUCP # BITNET relay host DBbeba.cesnet.cz CPBITNET # "Smart" relay host (may be null) #home operation DS[10.0.0.3] #karlin operation #DS[195.113.31.123] # place to which unknown users should be forwarded #Kuser user -m -a<> #DLname_of_luser_relay # operators that cannot be in local usernames (i.e., network indicators) CO @ % ! # a class with just dot (for identifying canonical names) C.. # a class with just a left bracket (for identifying domain literals) C[[ # Mailer table (overriding domains) #Kmailertable dbm /etc/mailertable # Domain table (adding domains) #Kdomaintable dbm /etc/domaintable # Generics table (mapping outgoing addresses) #Kgenerics dbm /etc/genericstable # Virtual user table (maps incoming users) #Kvirtuser dbm /etc/virtusertable # who I send unqualified names to (null means deliver locally) DR # who gets all local email traffic ($R has precedence for unqualified names) DH # dequoting map Kdequote dequote # class E: names that should be exposed as from this host, even if we masquerade # class L: names that should be delivered locally, even if we have a relay # class M: domains that should be converted to $M #CL root CE root # who I masquerade as (null for no masquerading) (see also $=M) DM # my name for error messages DnMAILER-DAEMON CPREDIRECT # Configuration version number DZ8.8.5 ############### # Options # ############### # strip message body to 7 bits on input? O SevenBitInput=False # 8-bit data handling O EightBitMode=pass8 # wait for alias file rebuild (default units: minutes) O AliasWait=10 # location of alias file O AliasFile=/etc/aliases # minimum number of free blocks on filesystem O MinFreeBlocks=100 # maximum message size #O MaxMessageSize=1000000 # substitution for space (blank) characters O BlankSub=. # avoid connecting to "expensive" mailers on initial submission? O HoldExpensive=False # checkpoint queue runs after every N successful deliveries #O CheckpointInterval=10 # default delivery mode O DeliveryMode=background # automatically rebuild the alias database? #O AutoRebuildAliases # error message header/file #O ErrorHeader=/etc/sendmail.oE # error mode #O ErrorMode=print # save Unix-style "From_" lines at top of header? #O SaveFromLine # temporary file mode O TempFileMode=0600 # match recipients against GECOS field? #O MatchGECOS # maximum hop count #O MaxHopCount=17 # location of help file O HelpFile=/usr/lib/sendmail.hf # ignore dots as terminators in incoming messages? #O IgnoreDots # name resolver options #O ResolverOptions=+AAONLY # deliver MIME-encapsulated error messages? O SendMimeErrors=True # Forward file search path O ForwardPath=$z/.forward.$w:$z/.forward # open connection cache size O ConnectionCacheSize=2 # open connection cache timeout O ConnectionCacheTimeout=5m # persistent host status directory #O HostStatusDirectory=.hoststat # single thread deliveries (requires HostStatusDirectory)? #O SingleThreadDelivery # use Errors-To: header? O UseErrorsTo=False # log level O LogLevel=9 # send to me too, even in an alias expansion? #O MeToo # verify RHS in newaliases? O CheckAliases=False # default messages to old style headers if no special punctuation? O OldStyleHeaders=True # SMTP daemon options #O DaemonPortOptions=Port=esmtp # privacy flags O PrivacyOptions=authwarnings # who (if anyone) should get extra copies of error messages #O PostMasterCopy=Postmaster # slope of queue-only function #O QueueFactor=600000 # queue directory O QueueDirectory=/var/spool/mqueue # timeouts (many of these) #O Timeout.initial=5m #O Timeout.connect=5m #O Timeout.iconnect=5m #O Timeout.helo=5m #O Timeout.mail=10m #O Timeout.rcpt=1h #O Timeout.datainit=5m #O Timeout.datablock=1h #O Timeout.datafinal=1h #O Timeout.rset=5m #O Timeout.quit=2m #O Timeout.misc=2m #O Timeout.command=1h #O Timeout.ident=30s #O Timeout.fileopen=60s O Timeout.queuereturn=12d #O Timeout.queuereturn.normal=5d #O Timeout.queuereturn.urgent=2d #O Timeout.queuereturn.non-urgent=7d O Timeout.queuewarn=3d #O Timeout.queuewarn.normal=4h #O Timeout.queuewarn.urgent=1h #O Timeout.queuewarn.non-urgent=12h O Timeout.hoststatus=1m # should we not prune routes in route-addr syntax addresses? #O DontPruneRoutes # queue up everything before forking? O SuperSafe=True # status file O StatusFile=/etc/sendmail.st # time zone handling: # if undefined, use system default # if defined but null, use TZ envariable passed in # if defined and non-null, use that info #O TimeZoneSpec= # default UID (can be username or userid:groupid) O DefaultUser=1:1 # list of locations of user database file (null means no lookup) #O UserDatabaseSpec=/etc/userdb # fallback MX host #O FallbackMXhost=[195.113.31.123] # if we are the best MX host for a site, try it directly instead of config err #O TryNullMXList # load average at which we just queue messages #O QueueLA=8 # load average at which we refuse connections #O RefuseLA=12 # maximum number of children we allow at one time #O MaxDaemonChildren=12 # maximum number of new connections per second #O ConnectionRateThrottle=3 # work recipient factor #O RecipientFactor=30000 # deliver each queued job in a separate process? #O ForkEachJob # work class factor #O ClassFactor=1800 # work time factor #O RetryFactor=90000 # shall we sort the queue by hostname first? #O QueueSortOrder=priority # minimum time in queue before retry #O MinQueueAge=30m # default character set #O DefaultCharSet=iso-8859-1 # service switch file (ignored on Solaris, Ultrix, OSF/1, others) O ServiceSwitchFile=/etc/sendmail.service.switch # hosts file (normally /etc/hosts) #O HostsFile=/etc/hosts # dialup line delay on connection failure #O DialDelay=10s # action to take if there are no recipients in the message #O NoRecipientAction=add-to-undisclosed # chrooted environment for writing to files #O SafeFileEnvironment=/arch # are colons OK in addresses? #O ColonOkInAddr # how many jobs can you process in the queue? #O MaxQueueRunSize=10000 # shall I avoid expanding CNAMEs (violates protocols)? #O DontExpandCnames # SMTP initial login message (old $e macro) O SmtpGreetingMessage=$j Sendmail $v/$Z; $b # UNIX initial From header format (old $l macro) O UnixFromLine=From $g $d # delimiter (operator) characters (old $o macro) O OperatorChars=.:%@!^/[]+ # shall I avoid calling initgroups(3) because of high NIS costs? #O DontInitGroups # are group-writable :include: and .forward files (un)trustworthy? #O UnsafeGroupWrites # where do errors that occur when sending errors get sent? #O DoubleBounceAddress # what user id do we assume for the majority of the processing? #O RunAsUser=sendmail ########################### # Message precedences # ########################### Pfirst-class=0 Pspecial-delivery=100 Plist=-30 Pbulk=-60 Pjunk=-100 ##################### # Trusted users # ##################### # this is equivalent to setting class "t" #Ft/etc/sendmail.ct Troot Tdaemon Tuucp ######################### # Format of headers # ######################### H?P?Return-Path: <$g> HReceived: $?sfrom $s $.$?_($?s$|from $.$_) $.by $j ($v/$Z)$?r with $r$. id $i$?u for $u; $|; $.$b H?D?Resent-Date: $a H?D?Date: $a H?F?Resent-From: $?x$x <$g>$|$g$. H?F?From: $?x$x <$g>$|$g$. H?x?Full-Name: $x # HPosted-Date: $a # H?l?Received-Date: $b H?M?Resent-Message-Id: <$t.$i@$j> H?M?Message-Id: <$t.$i@$j> # ###################################################################### ###################################################################### ##### ##### REWRITING RULES ##### ###################################################################### ###################################################################### ############################################ ### Ruleset 3 -- Name Canonicalization ### ############################################ S3 # handle null input (translate to <@> special case) R$@ $@ <@> # strip group: syntax (not inside angle brackets!) and trailing semicolon R$* $: $1 <@> mark addresses R$* < $* > $* <@> $: $1 < $2 > $3 unmark R@ $* <@> $: @ $1 unmark @host:... R$* :: $* <@> $: $1 :: $2 unmark node::addr R:include: $* <@> $: :include: $1 unmark :include:... R$* [ $* : $* ] <@> $: $1 [ $2 : $3 ] unmark IPv6 addrs R$* : $* [ $* ] $: $1 : $2 [ $3 ] <@> remark if leading colon R$* : $* <@> $: $2 strip colon if marked R$* <@> $: $1 unmark R$* ; $: $1 strip trailing semi # null input now results from list:; syntax R$@ $@ :; <@> # strip angle brackets -- note RFC733 heuristic to get innermost item R$* $: < $1 > housekeeping <> R$+ < $* > < $2 > strip excess on left R< $* > $+ < $1 > strip excess on right R<> $@ < @ > MAIL FROM:<> case R< $+ > $: $1 remove housekeeping <> # make sure <@a,@b,@c:user@d> syntax is easy to parse -- undone later R@ $+ , $+ @ $1 : $2 change all "," to ":" # localize and dispose of route-based addresses R@ $+ : $+ $@ $>96 < @$1 > : $2 handle # find focus for list syntax R $+ : $* ; @ $+ $@ $>96 $1 : $2 ; < @ $3 > list syntax R $+ : $* ; $@ $1 : $2; list syntax # find focus for @ syntax addresses R$+ @ $+ $: $1 < @ $2 > focus on domain R$+ < $+ @ $+ > $1 $2 < @ $3 > move gaze right R$+ < @ $+ > $@ $>96 $1 < @ $2 > already canonical # do some sanity checking R$* < @ $* : $* > $* $1 < @ $2 $3 > $4 nix colons in addrs # convert old-style addresses to a domain-based address R$- ! $+ $@ $>96 $2 < @ $1 .UUCP > resolve uucp names R$+ . $- ! $+ $@ $>96 $3 < @ $1 . $2 > domain uucps R$+ ! $+ $@ $>96 $2 < @ $1 .UUCP > uucp subdomains # if we have % signs, take the rightmost one R$* % $* $1 @ $2 First make them all @s. R$* @ $* @ $* $1 % $2 @ $3 Undo all but the last. R$* @ $* $@ $>96 $1 < @ $2 > Insert < > and finish # else we must be a local name R$* $@ $>96 $1 ################################################ ### Ruleset 96 -- bottom half of ruleset 3 ### ################################################ S96 # handle special cases for local names R$* < @ localhost > $* $: $1 < @ $j . > $2 no domain at all R$* < @ localhost . $m > $* $: $1 < @ $j . > $2  local domain R$* < @ localhost . UUCP > $* $: $1 < @ $j . > $2 .UUCP domain R$* < @ [ $+ ] > $* $: $1 < @@ [ $2 ] > $3 mark [a.b.c.d] R$* < @@ $=w > $* $: $1 < @ $j . > $3 self-literal R$* < @@ $+ > $* $@ $1 < @ $2 > $3 canon IP addr # look up domains in the domain table #R$* < @ $+ > $* $: $1 < @ $(domaintable $2 $) > $3 # pass UUCP addresses straight through R$* < @ $+ . UUCP > $* $@ $1 < @ $2 . UUCP . > $3 # pass to name server to make hostname canonical R$* < @ $* $~P > $* $: $1 < @ $[ $2 $3 $] > $4 # local host aliases and pseudo-domains are always canonical R$* < @ $=w > $* $: $1 < @ $2 . > $3 R$* < @ $j > $* $: $1 < @ $j . > $2 R$* < @ $* $=M > $* $: $1 < @ $2 $3 . > $4 R$* < @ $* $=P > $* $: $1 < @ $2 $3 . > $4 R$* < @ $* . . > $* $1 < @ $2 . > $3 ################################################## ### Ruleset 4 -- Final Output Post-rewriting ### ################################################## S4 R$* <@> $@ handle <> and list:; # strip trailing dot off possibly canonical name R$* < @ $+ . > $* $1 < @ $2 > $3 # eliminate internal code -- should never get this far! R$* < @ *LOCAL* > $* $1 < @ $j > $2 # externalize local domain info R$* < $+ > $* $1 $2 $3 defocus R@ $+ : @ $+ : $+ @ $1 , @ $2 : $3 canonical R@ $* $@ @ $1 ... and exit # UUCP must always be presented in old form R$+ @ $- . UUCP $2!$1 u@h.UUCP => h!u # delete duplicate local names R$+ % $=w @ $=w $1 @ $2 u%host@host => u@host ############################################################## ### Ruleset 97 -- recanonicalize and call ruleset zero ### ### (used for recursive calls) ### ############################################################## S97 R$* $: $>3 $1 R$* $@ $>0 $1 ###################################### ### Ruleset 0 -- Parse Address ### ###################################### S0 R<@> $#local $: <@> special case error msgs R$* : $* ; <@> $#error $@ 5.1.3 $: "list:; syntax illegal for recipient addresses" R<@ $+> $#error $@ 5.1.1 $: "user address required" R$* $: <> $1 R<> $* < @ [ $+ ] > $* $1 < @ [ $2 ] > $3 R<> $* <$* : $* > $* $#error $@ 5.1.1 $: "colon illegal in host name part" R<> $* $1 R$* < @ . $* > $* $#error $@ 5.1.2 $: "invalid host name" # handle numeric address spec R$* < @ [ $+ ] > $* $: $>98 $1 < @ [ $2 ] > $3 numeric internet spec R$* < @ [ $+ ] > $* $#esmtp $@ [$2] $: $1 < @ [$2] > $3 still numeric: send # now delete the local info -- note $=O to find characters that cause forwarding R$* < @ > $* $@ $>97 $1 user@ => user R< @ $=w . > : $* $@ $>97 $2 @here:... -> ... R$- < @ $=w . > $: $(dequote $1 $) < @ $2 . > dequote "foo"@here R< @ $+ > $#error $@ 5.1.1 $: "user address required" R$* $=O $* < @ $=w . > $@ $>97 $1 $2 $3 ...@here -> ... # handle local hacks R$* $: $>98 $1 # handle virtual users #R$+ < @ $=w . > $: < $(virtuser $1 @ $2 $@ $1 $: @ $) > $1 < @ $2 . > #R< @ > $+ < @ $+ . > $: < $(virtuser @ $2 $@ $1 $: @ $) > $1 < @ $2 . > #R< @ > $+ $: $1 #R< error : $- $+ > $* $#error $@ $( dequote $1 $) $: $2 #R< $+ > $+ < @ $+ > $: $>97 $1 # short circuit local delivery so forwarded email works #R$+ . USENET < @ $=w . > $#usenet $: $1 handle usenet specially R$=L < @ $=w . > $#local $: @ $1 special local names R$+ < @ $=w . > $#local $: $1 regular local name # not local -- try mailer table lookup #R$* <@ $+ > $* $: < $2 > $1 < @ $2 > $3 extract host name #R< $+ . > $* $: < $1 > $2 strip trailing dot #R< $+ > $* $: < $(mailertable $1 $) > $2 lookup #R< $~[ : $+ > $* $>95 < $1 : $2 > $3 check -- resolved? #R< $+ > $* $: $>90 <$1> $2 try domain # resolve remotely connected UUCP links (if any) # resolve fake top level domains by forwarding to other hosts R$*<@$+.BITNET.>$* $: $>95 < $B > $1 <@$2.BITNET.> $3 user@host.BITNET # forward non-local UUCP traffic to our UUCP relay R$*<@$*.UUCP.>$* $: $>95 < $Y > $1 <@$2.UUCP.> $3 uucp mail # pass names that still have a host to a smarthost (if defined) R$* < @ $* > $* $: $>95 < $S > $1 < @ $2 > $3 glue on smarthost name # deal with other remote names R$* < @$* > $* $#esmtp $@ $2 $: $1 < @ $2 > $3 user@host.domain # if this is quoted, strip the quotes and try again R$+ $: $(dequote $1 $) strip quotes R$+ $=O $+ $@ $>97 $1 $2 $3 try again # handle locally delivered names R$=L $#local $: @ $1 special local names R$+ $#local $: $1 regular local names ########################################################################### ### Ruleset 5 -- special rewriting after aliases have been expanded ### ########################################################################### S5 # deal with plussed users so aliases work nicely R$+ + * $#local $@ $&h $: $1 R$+ + $* $#local $@ $2 $: $1 + * # prepend an empty "forward host" on the front R$+ $: <> $1 # send unrecognized local users to a relay host #R< > $+ + $* $: < $L . > $( user $1 $) + $2 #R< > $+ $: < $L . > $( user $1 $) look up user #R< $* > $+ <> $* $: < > $2 $3 found; strip $L #R< $* . > $+ $: < $1 > $2 strip extra dot # handle plussed local names R< > $+ + $* $#local $@ $2 $: $1 # see if we have a relay or a hub R< > $+ $: < $H > $1 try hub R< > $+ $: < $R > $1 try relay R< > $+ $@ $1 nope, give up R< local : $* > $* $: $>95 < local : $1 > $2 no host extension R< error : $* > $* $: $>95 < error : $1 > $2 no host extension R< $- : $+ > $+ $: $>95 < $1 : $2 > $3 < @ $2 > R< $+ > $+ $@ $>95 < $1 > $2 < @ $1 > ################################################################### ### Ruleset 90 -- try domain part of mailertable entry ### ################################################################### S90 #R$* <$- . $+ > $* $: $1$2 < $(mailertable .$3 $@ $1$2 $@ $2 $) > $4 #R$* <$~[ : $+ > $* $>95 < $2 : $3 > $4 check -- resolved? #R$* < . $+ > $* $@ $>90 $1 . <$2> $3 no -- strip & try again #R$* < $* > $* $: < $(mailertable . $@ $1$2 $) > $3 try "." #R< $~[ : $+ > $* $>95 < $1 : $2 > $3 "." found? #R< $* > $* $@ $2 no mailertable match ################################################################### ### Ruleset 95 -- canonify mailer:[user@]host syntax to triple ### ################################################################### S95 R< > $* $@ $1 strip off null relay R< error : $- $+ > $* $#error $@ $( dequote $1 $) $: $2 R< local : $* > $* $>CanonLocal < $1 > $2 R< $- : $+ @ $+ > $*<$*>$* $# $1 $@ $3 $: $2<@$3> use literal user R< $- : $+ > $* $# $1 $@ $2 $: $3 try qualified mailer R< $=w > $* $@ $2 delete local host R< $+ > $* $#relay $@ $1 $: $2 use unqualified mailer ################################################################### ### Ruleset CanonLocal -- canonify local: syntax ### ################################################################### SCanonLocal # strip trailing dot from any host name that may appear R< $* > $* < @ $* . > $: < $1 > $2 < @ $3 > # handle local: syntax -- use old user, either with or without host R< > $* < @ $* > $* $#local $@ $1@$2 $: $1 R< > $+ $#local $@ $1 $: $1 # handle local:user@host syntax -- ignore host part R< $+ @ $+ > $* $: < $1 > $3 # handle local:user syntax R< $+ > $* <@ $* > $* $#local $@ $2@$3 $: $1 R< $+ > $* $#local $@ $2 $: $1 ################################################################### ### Ruleset 93 -- convert header names to masqueraded form ### ################################################################### S93 # handle generics database #R$+ < @ $=G . > $: < $1@$2 > $1 < @ $2 . > @ mark #R$+ < @ *LOCAL* > $: < $1@$j > $1 < @ *LOCAL* > @ mark #R< $+ > $+ < $* > @ $: < $(generics $1 $: $) > $2 < $3 > #R< > $+ < @ $+ > $: < $(generics $1 $: $) > $1 < @ $2 > #R< $* @ $* > $* < $* > $@ $>3 $1 @ $2 found qualified #R< $+ > $* < $* > $: $>3 $1 @ *LOCAL* found unqualified #R< > $* $: $1 not found # special case the users that should be exposed R$=E < @ *LOCAL* > $@ $1 < @ $j . > leave exposed R$=E < @ $=M . > $@ $1 < @ $2 . > R$=E < @ $=w . > $@ $1 < @ $2 . > # handle domain-specific masquerading R$* < @ $=M . > $* $: $1 < @ $2 . @ $M > $3 convert masqueraded doms R$* < @ $=w . > $* $: $1 < @ $2 . @ $M > $3 R$* < @ *LOCAL* > $* $: $1 < @ $j . @ $M > $2 R$* < @ $+ @ > $* $: $1 < @ $2 > $3 $M is null R$* < @ $+ @ $+ > $* $: $1 < @ $3 . > $4 $M is not null ################################################################### ### Ruleset 94 -- convert envelope names to masqueraded form ### ################################################################### S94 #R$+ $@ $>93 $1 R$* < @ *LOCAL* > $* $: $1 < @ $j . > $2 ################################################################### ### Ruleset 98 -- local part of ruleset zero (can be null) ### ################################################################### S98 # addresses sent to foo@host.REDIRECT will give a 551 error code R$* < @ $+ .REDIRECT. > $: $1 < @ $2 . REDIRECT . > < ${opMode} > R$* < @ $+ .REDIRECT. > $: $1 < @ $2 . REDIRECT. > R$* < @ $+ .REDIRECT. > < $- > $# error $@ 5.1.1 $: "551 User has moved; please try " <$1@$2> # ###################################################################### ###################################################################### ##### ##### MAILER DEFINITIONS ##### ###################################################################### ###################################################################### ################################################## ### Local and Program Mailer specification ### ################################################## ##### @(#)local.m4 8.23 (Berkeley) 5/31/96 ##### Mlocal, P=/usr/bin/procmail, F=lsDFMAw5:/|@qSPfhn9, S=10/30, R=20/40, T=DNS/RFC822/X-Unix, A=procmail -Y -a $h -d $u Mprog, P=/bin/sh, F=lsDFMoqeu9, S=10/30, R=20/40, D=$z:/, T=X-Unix, A=sh -c $u # # Envelope sender rewriting # S10 R<@> $n errors to mailer-daemon R$+ $: $>50 $1 add local domain if needed R$* $: $>94 $1 do masquerading # # Envelope recipient rewriting # S20 R$+ < @ $* > $: $1 strip host part # # Header sender rewriting # S30 R<@> $n errors to mailer-daemon R$+ $: $>50 $1 add local domain if needed R$* $: $>93 $1 do masquerading # # Header recipient rewriting # S40 R$+ $: $>50 $1 add local domain if needed #R$* $: $>93 $1 do all-masquerading # # Common code to add local domain name (only if always-add-domain) # S50 R$* < @ $* > $* $@ $1 < @ $2 > $3 already fully qualified R$+ $@ $1 < @ *LOCAL* > add local qualification ##################################### ### SMTP Mailer specification ### ##################################### ##### @(#)smtp.m4 8.33 (Berkeley) 7/9/96 ##### Msmtp, P=[IPC], F=mDFMuX, S=11/31, R=21, E=\r\n, L=990, T=DNS/RFC822/SMTP, A=IPC $h Mesmtp, P=[IPC], F=mDFMuXa, S=11/31, R=21, E=\r\n, L=990, T=DNS/RFC822/SMTP, A=IPC $h Msmtp8, P=[IPC], F=mDFMuX8, S=11/31, R=21, E=\r\n, L=990, T=DNS/RFC822/SMTP, A=IPC $h Mrelay, P=[IPC], F=mDFMuXa8, S=11/31, R=61, E=\r\n, L=2040, T=DNS/RFC822/SMTP, A=IPC $h # # envelope sender rewriting # S11 R$+ $: $>51 $1 sender/recipient common R$* :; <@> $@ list:; special case R$* $: $>61 $1 qualify unqual'ed names R$+ $: $>94 $1 do masquerading # # envelope recipient rewriting -- # also header recipient if not masquerading recipients # S21 R$+ $: $>51 $1 sender/recipient common R$+ $: $>61 $1 qualify unqual'ed names # # header sender and masquerading header recipient rewriting # S31 R$+ $: $>51 $1 sender/recipient common R:; <@> $@ list:; special case # do special header rewriting R$* <@> $* $@ $1 <@> $2 pass null host through R< @ $* > $* $@ < @ $1 > $2 pass route-addr through R$* $: $>61 $1 qualify unqual'ed names R$+ $: $>93 $1 do masquerading # # convert pseudo-domain addresses to real domain addresses # S51 # pass s through R< @ $+ > $* $@ < @ $1 > $2 resolve # output fake domains as user%fake@relay R$+ <@ $+ .BITNET. > $: $1 % $2 .BITNET < @ $B > user@host.BITNET R$+.BITNET <@ $+:$+ > $: $1 .BITNET < @ $3 > strip mailer: part # do UUCP heuristics; note that these are shared with UUCP mailers R$+ < @ $+ .UUCP. > $: < $2 ! > $1 convert to UUCP form R$+ < @ $* > $* $@ $1 < @ $2 > $3 not UUCP form # leave these in .UUCP form to avoid further tampering R< $&h ! > $- ! $+ $@ $2 < @ $1 .UUCP. > R< $&h ! > $-.$+ ! $+ $@ $3 < @ $1.$2 > R< $&h ! > $+ $@ $1 < @ $&h .UUCP. > R< $+ ! > $+ $: $1 ! $2 < @ $Y > use beba.cesnet.cz R$+ < @ $+ : $+ > $@ $1 < @ $3 > strip mailer: part R$+ < @ > $: $1 < @ *LOCAL* > if no beba.cesnet.cz # # common sender and masquerading recipient rewriting # S61 R$* < @ $* > $* $@ $1 < @ $2 > $3 already fully qualified R$+ $@ $1 < @ *LOCAL* > add local qualification # # relay mailer header masquerading recipient rewriting # S71 R$+ $: $>61 $1 R$+ $: $>93 $1 - . ...ld.so.1/ ld-2.0.7.so0 libc-2.0.7.so1 ld-linux.so.12 libc.so.63 ld-linux.so.24 libnss_files-2.0.7.so5libnss_files.so.16libpthread-0.7.so7libpthread.so.08 libpthread.so9 libcrypt.so.1:libtermcap.so.2; libcrypt.so<libcrypt-2.0.7.so=libtermcap.so.2.0.8>libncurses.so.4?Llibncurses.so.4.2ELFR4|4 (p66666 ))p" 5 =L ppppp ppp p p_DYNAMIC_GLOBAL_OFFSET_TABLE__procedure_table_procedure_string_table_procedure_table_sizelongjmp__libc_internal_tsd_set_IO_remove_marker__fcloseall_dl_setup_hash_IO_link_inunsetenvgsignal_IO_sputbackc_IO_default_finishbcmp__syscall_sigaction__longjmp_dl_receive_error_IO_file_finish_flush_cacheioctl__internal_ftrylockfile__pthread_mutexattr_destroy_dl_sysdep_messagegetgid__syscall_sigprocmask__getpid_nl_load_domain_IO_default_doallocate__libc_multiple_libcs_wordcopy_fwd_aligned_gp_disp_IO_default_sync_IO_file_sync__pthread_once_IO_fflush__pthread_mutex_lock_IO_file_writestrerrorgeteuidmemmove__tcgetattr_dl_new_object_cleanup_IO_default_xsgetnmunmap_IO_get_column_dl_load_cache_lookup__write_IO_sgetn__mmap__mprotect__syscall_fstatgetenv_IO_file_seekerrno_dl_sysdep_startgetegid__pthread_key_create_IO_init_marker_IO_stdout_getpidgetpagesize_IO_flush_all_linebuffered_dl_sysdep_start_cleanup__read__pthread_atfork_IO_default_underflow_dl_rtld_map_IO_funlockfilememcpy_IO_default_xsputn_IO_stderr__IO_default_setbuf_IO_sungetc__overflow__pthread_mutex_init_IO_flockfilegetuid_IO_file_close_nl_msg_cat_cntrmalloc__open_IO_unsave_markersisattycacheflush_dl_lookup_symbol_skip_IO_syncsys_nerr_dl_object_relocation_scope__strsep_dl_fini_dl_sysdep_error__dcgettext_IO_file_seekoff_pthread_cleanup_pop_restore__getgid___brk_addr_IO_file_setbuffflush_environ_IO_default_write__libc_read__pthread_initializelseek__pthread_mutexattr_setkind_np__environmmapbzeroabort__sigjmp_save__libc_enable_secureftrylockfile__sigsetjmp_dl_lookup_symbol__kill_IO_default_read_IO_file_close_it_sys_nerr_dl_global_scope_dl_skip_args__libc_internal_tsd_getfflush_locked_IO_file_stat__pthread_mutex_unlock_dl_rpath_dl_runtime_resolve__pthread_getspecificwriteenviron_IO_stdin_kill__pthread_mutex_trylock_dl_argcdcgettext__isatty_dl_debug_state_dl_global_scope_end__start_IO_cleanup_dl_argv_IO_default_seekpos_IO_file_underflowsyscall_error_IO_file_overflowmemchr_itoa__pthread_mutex_destroy_IO_flush_all_IO_adjust_column_dl_init_nextreadstrncmp_IO_ftrylockfile_IO_marker_delta__ioctl_wordcopy_bwd_dest_alignedfunlockfilerealloc__getegidfcloseall_dl_debug_initialize_IO_file_xsputn__brk_IO_unbuffer_all_IO_default_statmemcmp_dl_sysdep_fatal_strerror_internal_IO_marker_differencesigaction__pthread_mutexattr_init__getpagesize_IO_free_backup_area__syscall_error_IO_file_initsbrk_itoa_lower_digits__libc_close__underflowindex_pthread_cleanup_push_defer__libc_open_IO_default_uflowmemset_sys_errlist_dl_relocate_objecttcgetattrsys_errlist__uflow__assert_fail_IO_least_marker__lseekstrcmp_dl_starting_up_IO_setb_IO_file_fopen_IO_set_column_IO_file_doallocate_wordcopy_fwd_dest_aligned_libc_intl_domainnameflockfile_IO_file_read__internal_funlockfile_IO_file_jumpsstrsep_libio_using_thunks_dl_default_scope__libc_lseek_IO_file_attach_dl_start_user__internal_flockfile_dl_map_objectstpncpy__close__getuid_itoa_upper_digits_dl_library_path_IO_switch_to_get_mode_end_IO_do_write_fxstat__sigaction__curbrk_IO_default_seekoff_IO_doallocbuf_dl_signal_error_IO_nobackup_pbackfail__errno_location_IO_switch_to_backup_area__munmap__pthread_setspecific__fxstatbrk__assert_perror_fail__sigprocmask_exit__sigsetjmp_auxstrspnstrlenopen__libc_write_IO_initstrchr__sbrkmprotect_IO_default_seek_r_debug_IO_list_all_dl_sysdep_read_whole_file_dl_catch_error_IO_un_link_IO_default_pbackfailclose_dl_map_object_from_fd_dl_pagesize__geteuid_wordcopy_bwd_aligned__stpncpystrpbrk_IO_switch_to_main_get_arearaise_IO_seekmarkfreesigprocmask_dl_map_object_deps__start___libc_atexit__stop___libc_atexit_gpld.so.1/lib:/usr/lib.text.init.fini.data.rodata.sdata.sbss.bssR 666*#L*pA0A = 1I_T϶0"g!x\@$@Hxʶ "h80"p3(ֶ /Pֶ(<6"BZ!vɶPԶ"3(2(p8( $(*!9 D!Y.hPqԶ"y 5pT"(ն" pPն"Hն(ֶ(@(ڶ-D-pA3ö`DԶ"L!aq@9P}2""@PǶ2"! 6T" <)9P5THTLH_!t"Ӷ"H.D :p˶"Զ"4d05"Pֶ"@L @x!`*¶3ɶD϶x"P)a!~PԶ(: "x ":!(2(!03"! :ն"1 @׶X&<϶"48I"VҶ$btp2({X@L`8(8! "-L!80!FPն"L: T8P_p2"d!|8϶"05öd8RTh8DL$`Ҷ"x&4!,(۶t.!FTTft2"y"d6(0$"4ζ"Զ("ö\ X/8 ` * ; 0B dȶS <f | " !   `Ҷ0 h " =% ն( p @" !3 Զ(? tQ X 0:|e  y 5" 0: t ж" T 03" `@ $8  X   3P + ;A "K t-DY p <L `" > @8 03( ," R   " ն" Ӷ( =%( 89 P EU l#\b "j v : T \  X Ҷ" @ ն( ! p `"! Ѷ8"6 `D ӶJ ҶZ pa 0h Զ"m Pն(z 8 @  ֶ"  p8 9 dǶ Կ P| ն"Xz+<88Զ(B0X bpjhD dTͶ@"`"=={urIXQMq\C 6G[7ymRU4$B2*f }lj !)c| ao/ S,: <` %zPv.J#@A?V-idEknYes(+K"1 h~pgLWwH=;F&8T0txN9>_D^bO3 'Z ]5cannot find runtime link mapbad dynamic tag! "bad dynamic tag"dynamic-link.helf_get_dynamic_infoinfo[9]->d_un.d_val == sizeof (Elf32_Rela)info[19]->d_un.d_val == sizeof (Elf32_Rel)info[20]->d_un.d_val == 17 || info[20]->d_un.d_val == 7LD_TRACE_LOADED_OBJECTSLD_LIBRARY_PATHLD_BIND_NOWUsage: ld.so [--list|--verify] EXECUTABLE-FILE [ARGS-FOR-PROGRAM...] You have invoked `ld.so', the helper program for shared library executables. This program usually lives in the file `/lib/ld.so', and special directives in executable files using ELF shared libraries tell the system's program loader to load the helper program from this file. This helper program loads the shared libraries needed by the program executable, prepares the program to run, and runs it. You may invoke this helper program directly from the command line to load and run an ELF executable file; this is like executing that file itself, but always uses this helper program from the file you specified, instead of the helper program file specified in the executable file you run. This is mostly of use for maintainers to test new versions of this helper program; chances are you did not intend to run this program. --list--verify--data-relocs--function-relocs--library-pathcannot allocate memory for link map_dl_rtld_map.l_libnamertld.cdl_mainLD_PRELOAD :/etc/ld.so.preload: i == npreloads_dl_rtld_map.l_prev->l_next == _dl_rtld_map.l_next_dl_rtld_map.l_next->l_prev == _dl_rtld_map.l_prev statically linked => not found => (0x) argument found at 0x in object at 0x !!``! (cannot find runtime link mapbad dynamic tag! "bad dynamic tag"dynamic-link.helf_get_dynamic_infoinfo[9]->d_un.d_val == sizeof (Elf32_Rela)info[19]->d_un.d_val == sizeof (Elf32_Rel)info[20]->d_un.d_val == 17 || info[20]->d_un.d_val == 7failed to map segment from shared objectcannot map file datainvalid ELF headerELF file class not __ELF_WORDSIZE-bitELF file data encoding not little-endianELF file version ident not EV_CURRENTELF file version not EV_CURRENTELF file machine architecture not MIPSELF file's phentsize not the expected sizecannot create shared object descriptorELF load command alignment not page-alignedELF load command address/offset not properly alignedcannot change memory protectionscannot map zero-fill pagesloadcmds[0].mapoff == 0dl-load.c_dl_map_object_from_fdobject file has no dynamic section:;/usr/lib/libLD_LIBRARY_PATHcannot open shared object file/etc/ld.so.cacheld.so-1.7.0undefined symbol: i < (*scope)->l_ndupsearchlistdl-lookup.c_dl_lookup_symbol_skipundefined symbol: cannot find runtime link mapbad dynamic tag! "bad dynamic tag"dynamic-link.helf_get_dynamic_infoinfo[9]->d_un.d_val == sizeof (Elf32_Rela)info[19]->d_un.d_val == sizeof (Elf32_Rel)info[20]->d_un.d_val == 17 || info[20]->d_un.d_val == 7cannot make segment writable for relocationunexpected dynamic reloc type! "unexpected dynamic reloc type"../sysdeps/mips/dl-machine.helf_machine_relcan't restore segment prot after reloccannot allocate symbol search list!!``! cannot find runtime link mapbad dynamic tag! "bad dynamic tag"dynamic-link.helf_get_dynamic_infoinfo[9]->d_un.d_val == sizeof (Elf32_Rela)info[19]->d_un.d_val == sizeof (Elf32_Rel)info[20]->d_un.d_val == 17 || info[20]->d_un.d_val == 7unexpected dynamic reloc type! "unexpected dynamic reloc type"../sysdeps/mips/dl-machine.helf_machine_relDYNAMIC LINKER BUG!!!: : error in loading shared libraries l ll8lD\Phn <= _dl_pagesizedl-minimal.cmallocpage != (caddr_t) -1ptr == alloc_last_blockreallocnew == ptrdomainname == _libc_intl_domainname__dcgettextBUG IN DYNAMIC LINKER ld.so: : Assertion `' failed! Unexpected error: libc$@B1@8@ C0b(2@0`t̏pŏ(Ư,ǯ0ȯ4ɯ8ʯ! 8 ܏(Ə,Ǐ0ȏ4ɏ8ʏ@ v$b p"bb@p"bH#!CR@&+@&!$Œ@8@t͏@$ B-Cpď ܏C$c$#5%  "'F$pŏ'L ܏! |ŏ!0 ܏ÏtΏí!hd\XTPLHD@p'<'!(c!CEB$D!C@H<'!'! !$!T$,(x !@! (!!(T$ $PH8$$Cc2%CP ! b@ c b@ p!,$ 0'$$ tcE!$"E!$#E&!  !@! ,'<4,$@!C@#!B! `!0 +2!!0@! !(L ! ! +2@!(`#0Q< @!U@ !T!($ LD@<840P'<л'!'0 @!b'@#dc$b0@!(`<4<4#F$G@$@$#db@#d B$b@#db@#dB$B$ '<'!!8,'@!@$0@$C#C$0@$C$0@$C$0@$C%0 $0@$C$#<'!@!0€Ð @G$!€Ð@$@!0!<'!@!@!0€Ð@$€Ð@€@$!@%!<'!' 00 @!8;E!$$!8~ <%@%@,$@J5 <)5$$&h!j'&C$I@$E$!`bE$bE$bE!$,@$! E!$!@$! '<з'!',@H0 @0$#b@$0@$0t`h!@Xg1$!$$ $$@k%$$*k%$$k%b I' ' %bc$# i ''%bc$#b I(','(,%bc$# i %8'<'8<%bc$#k%`c$I' ' %bc$#$$8p $#xN1$b!P`$b$ b$$K%$2%$$$%%bK l' ' %b$O#b%bL k''%b$<#b%bK l(','(,%b$)#b%b L k8'<'8<%b$#b$%J%%b l' ' %b$#b!@$$! !(0 !$#b@$$!P'< '!'$! !!`!#p+R,0@(B.#@#B0!@`#B&c$"`1&2 @! !(0  $!(0P $$B!!"R28@!@&c$"`1&1!`!B.#@!r"2!@`#B&1&c$`"2 @! !(08  $!(0 $$B##"R2!0@!`&1&$"!`,$ 0'<@'!,)@!@0%8%80@B%1@$B` %%GGGGGG B$' )%c$` %0`c$`%0$%!<`'!,!@!8$@$$@$$ @$c$ `$@$##00!$$@$!!@!@$$<`'!'$! !!`!B.,$@(#B0!@`#B&c$"`1&2 @! !(0  $!(0P $$B!!"R2!0@!`&$"1&!`,$ 0'<@'!0,.@@>!$!""!\@$$.$$$'$$$ $$$$$$$$$ $$$$  $$ $<'!0$$(X $#`K0$b`$b$ bi$$$$$$ $$$i%Cj%Cg%C $h%C $$i%C<'!0,0@`>!$!""!\@$$0$$$)$$$ "$$$$$$$$$ $$$$$ $ $$$<Ъ'!0$$(X $#`K0$b$`$b$ bi$$!$$$ $$ $$$$i %C g%Ch%C$j%C$$i%C <'!'!$ 0! !@ @@B$" !$('<'!H'!$$ ! =! !( ?!@' (,048<HhlPX`!@ (,4<D $ 0 P T 8 @HLhlptx| ă $$#C!'<'!'$! :!$"+D@ !ă ! @$ $# '<'!'B!$ @B @! @$ !  !@`$!B$('<0'!$<'!<'!<襜'!$p <'! $ <'!('!$!Ď$® !(| !@r!@$!(` 'ԃ @! `P(@$! $ !@P! ` $Px !@@!@P$! `!( !08 T#!"! ` <CB4b<B4b$ ! @P̃ P $x @®>>>>>>x&$X/)"(t-.-H.-T=T϶x$xʶ h80p3ֶPֶ6ɶPԶ32p8$( .Զ 5pTն Pննֶ@ڶ-pAöԶ@92@PǶ2 6 9TLӶH. :p˶Զ405Pֶ@L@`¶ɶ϶)PԶ:" :(203:ն1@׶<϶8Ҷp2XL`8(8 -8Pն:8p28϶05öd8RT8D$`Ҷx&۶2604ζԶöX/`0dȶ`Ҷ=ն@Զ  0:50:ж03`$8X 3;t-<` >@803,"R նӶ= 8El#:T\Ҷն`Ѷ`ӶҶp0ԶPն8@ֶp89dǶԿPնXz<8Զ h TͶ`==H%09%,9%(9%$9% 9%9%9%9%9% 9%9%9%~@>%~D>%~H>%~L>%~P>%~T>%~X>%~\>%~`>%~d>%~h>%~l>%~p>%~t>%~x>%~|>j@508j@448j@`8j@ d8j@8 9j@$9j@8t9j@(99j@9j@@99j@ؐ99j@9j@ب99j@ؤL0:j@،L4:j@pL8:j@`L<:j@HL@:j@4LD:j@LH:j@LL:j@KP:j@KT:j@KX:j@ظK\:j@بK`:j@ؔKd:j@؈Kh:j@pKl:j@dKp:j@XKt:j@<j@><j@><j@><j@ج><j@ؘ><j@؀><j@ؘ<j@x&<j@$<j@<j@<j@X/<j@<j@ؤ)<j@<j@"<j@ج(<j@<j@t-<j@،.<j@ظ-<j@H.<j@-<j@T=R@T#Z8-`[05[=@w(E\T8VT@eVkcq kXx8hVpX0p8`TXlXPl u ( @TP U  HW(  (   RH W ?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ddir_rreaddir_rrewinddirlseekseekdirtelldirscandiralphasort__getdentsgetdirentriesdirfdfgetgrent__fgetgrent_rinitgroupssysconfsetgrent__getgrent_rendgrentsetgroupsgetgrentgetgrgid__getgrgid_rgetgrnam__getgrnam_r__nss_group_lookup__nss_lookup__nss_nextgetgrent_rgetgrgid_rgetgrnam_r_nss_files_parse_grentfgetgrent_rfgetpwent__fgetpwent_r__getpwgetpwuid_rgetpwputpwentgetpwent__getpwent_rgetpwnam__getpwnam_rgetpwuid__nss_passwd_lookupsetpwentendpwentgetpwent_rgetpwnam_r_nss_files_parse_pwentfgetpwent_runametimes__libc_wait__wait4__waitwait__libc_waitpidwaitpid__wait3wait3wait4alarmsleep__nanosleep__libc_pausepause__libc_nanosleepnanosleepforkvforkexecvefexecveexecvexecleexecvpconfstrexeclpgetpid__getppidgetppid__getuidgetuid__geteuid__getgidgetgid__getegidgetegid__getgroupsgetgroups__setuidsetuid__setgidsetgid__group_membergroup_member__getpgidgetpgid__setpgidsetpgidgetpgrpsetpgrpgetsid__setsidsetsidgetlogin__ttyname_r__setutent__getutline_r__endutentgetlogin_rttyname_rclosesetlogin__pathconf__statfspathconf__getdtablesize__get_nprocs_conf__get_nprocs__get_phys_pages__get_avphys_pages__fpathconf__fstatfsfpathconfglob__glob_pattern_pglobfreeglob_pattern_pfnmatchre_set_syntaxre_syntax_optionsre_max_failureswctypeiswctypere_compile_fastmapre_set_registersre_searchre_search_2re_matchre_match_2re_compile_patternre_compre_execregerroroptargoptind__getopt_initializedopterroptopt__getopt_nonoption_flags_getopt_internalgetoptgetopt_longgetopt_long_only__sched_setparamsched_setparam__sched_getparamsched_getparam__sched_setschedulersched_setscheduler__sched_getschedulersched_getscheduler__sched_yieldsched_yield__sched_get_priority_maxsched_get_priority_max__sched_get_priority_minsched_get_priority_min__sched_rr_get_intervalsched_rr_get_intervalgetservbynamehtonsinet_ptongethostbyname2gethostbyaddrinet_ntopgetaddrinfofreeaddrinfoenviron_environutimemkfifo__xmknod__syscall_stat_xstat__syscall_fstat_fxstat__syscall_lstat_lxstat__syscall_mknod_xmknodstatfsfstatfs__umaskumask__chmodchmod__fchmodfchmod__mkdirmkdir__libc_open__libc_close__libc_readread__libc_writewrite__libc_lseek__accessaccess__euidaccesseuidaccess__libc_fcntlfcntl__flockflocklockf__dupdupdup2pipecreat__chdirchdirfchdirgetwdget_current_dir_name__chownchown__fchownfchown__lchownlchown__ttynamettyname__tcgetattrisatty__linklink__symlinksymlink__readlinkunlinkrmdirftwfts_openfts_closefts_readfts_setfts_children__syscall_pollpoll__selectcfgetospeedcfgetispeedcfsetospeedcfsetispeedcfsetspeedtcsetattr__ioctltcgetattrtcgetpgrptcsetpgrp__libc_tcdraintcdraintcfl